SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000016599 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000016599
Domain Number 1 Region: 34-175
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000385
Family C-type lectin domain 0.0083
Further Details:      
 
Domain Number 2 Region: 256-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000016599
Sequence length 484
Comment (Cavia porcellus)
Sequence
MRPALALCLLCQAFWPRPGYAEHPTADRAGCLASGACYSLHHATIKRPAAEEACNLRGGA
LSTVHAGAELRAVLALLRAGPGPGGGSKDLVFWVALERGRSHCTQENEPLRGFSWLTSDT
SASENDTLPWVEEPQRSCTVRKCAGLQATRGLEPAGWKEMRCHLRASGYLCKYQFENLCP
APYPGAASNLSYRAPFQLHSSALDFSPPGTKVSATCPGELSISATCVEEETGARWDGLPS
RPVLCSCPGSYLRAGRCAELAHCLDGLGDFACECAEGFELGKDRRSCVTKKEGQLPLEAT
NVPTWSQPATAASPVPKRTRSPRVHEKPGERPPSVPAATSVPEILPWGAQSTLSSLQISP
HTKLTTSLTPSGSMVPTFNSTPASSVPQAFGYASTVVFIFVSIAVVVLVILTMTVLGLFK
LCFHKSPSSQPRKGPLAPGGLESEAERSSSAHCTDNGVKVRDSSLQGRVEDCSLAGSPHS
SWVT
Download sequence
Identical sequences XP_003471950.2.53824 10141.ENSCPOP00000016599 ENSCPOP00000016599 ENSCPOP00000016599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]