SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000017638 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000017638
Domain Number 1 Region: 120-234
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-26
Family C-type lectin domain 0.00000935
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000017638
Sequence length 235
Comment (Cavia porcellus)
Sequence
MKLLLLLALLLGAVSTRHLKVDTSSLQSLRGEESLAQDGETAEGATREATAGALMPLPEE
EEMEGASGSEDDPEEEEEEEEEEEVEFSSELDVSPEDIQCPKEEDTVKFFSRPGYKTRGY
VMVGSARTFNEAQWVCQRCYRGNLASIHSFAFNYQVQCTSAGLNVAQVWIGGQLRGKGRC
RRFVWVDRTVWNFAYWARGQPWGGRQRGRCVTLCARGGHWRRSHCGKRRPFVCTY
Download sequence
Identical sequences H0W3U0
10141.ENSCPOP00000017638 ENSCPOP00000017638 ENSCPOP00000000424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]