SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10141.ENSCPOP00000020948 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10141.ENSCPOP00000020948
Domain Number 1 Region: 654-842
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-44
Family cAMP-binding domain 0.00061
Further Details:      
 
Domain Number 2 Region: 377-552,582-634
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-40
Family Voltage-gated potassium channels 0.0037
Further Details:      
 
Domain Number 3 Region: 13-108
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.11e-20
Family Flavin-binding PAS domain 0.0000264
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10141.ENSCPOP00000020948
Sequence length 1163
Comment (Cavia porcellus)
Sequence
DKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVMQKPCTCDFLHGPETKRHDIAQIAQA
LLGSEERKVEVTYYHKNGSTFICNTHIIPVKNQEGVAMMFIINFEYVTDEENAASPERVN
PILPVKTVNRKLFGFKFPGLRVLSYRKQSLPQEDPDVVVIDSSKHSDDSVAMKHFKSPTK
ESCSPSEADDTKALIQPSKCSPLVNISGPLDHSSPKRQWDRLYPDMLQSSSQLTHSRSRE
SLCSIRRASSVHDIEGFSVHPKNIFRDRHASEDNGRNVKGPFNHIKSSLLGSTSDSNLNK
YSTINKIPQLTLNFSDVKTEKKNTSPPSSDKTIIAPKVKERTHNVTEKVTQVLSLGADVL
PEYKLQTPRINKFTILHYSPFKAVWDWLILLLVIYTAIFTPYSAAFLLNDREEQKRRECG
YSCSPLNVVDLIVDIMFIIDILINFRTTYVNQNEEVVSDPAKIAIHYFKGWFLIDMVAAI
PFDLLIFGSGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLMLLMCIFALIAHW
LACIWYAIGNVERPYLTDKIGWLDSLGQQIGKHYNESDSSSGPSIKDKYVTALYFTFSSL
TSVGFGNVSPNTNSEKIFSICVMLIGCYKTGSITLMYASIFGNVSAIIQRLYSGTARYHM
QMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMQVLKGFPECLQADICLHLNQ
TLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHCGDVLTALYFLSRGSIEILKDDI
VVAILGKNDIFGEMVHLYAKPGKSNADVRALTYCDLHKIQREDLLEVLDMYPEFSDHFLT
NLELTFNLRHESAKSMNDSERNFKLRRRRLSFESEGDKDFGKENSTNDPEDSTDTIRHYQ
SSKKHFEEKKSRSSSFISSIDDEQKPLFSGTVDSTPRLGKATGLQFEETMPTSGRMHTDK
RSHSCRDITGMQSWEEHHTRTQPEECSTPALQQTAWGTSETESDLTYGEVEQRLDLLQEQ
LNRLESQMTADIQTILQLLQKQTTVVPPAYSMVTAGAEYQRPILRLMRTSHPTASIKTDR
SFSPSSQCPEFLDLEKSKLKSKESLSSGVHLNTASEDNLTSLLKQDSDVSLELHLRQRKT
YFHPIRHPSLPDSSLSTVGILSL
Download sequence
Identical sequences 10141.ENSCPOP00000020948 ENSCPOP00000001419 ENSCPOP00000020948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]