SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 103690.all1716 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  103690.all1716
Domain Number 1 Region: 227-420
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.24e-48
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1003-1172
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.11e-48
Family Histidine kinase 0.00075
Further Details:      
 
Domain Number 3 Region: 1-141
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 9.42e-40
Family Methylesterase CheB, C-terminal domain 0.00036
Further Details:      
 
Domain Number 4 Region: 1204-1329
Classification Level Classification E-value
Superfamily CheY-like 1.08e-29
Family CheY-related 0.0057
Further Details:      
 
Domain Number 5 Region: 935-1015
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 4.32e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0019
Further Details:      
 
Domain Number 6 Region: 154-228
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000000034
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0095
Further Details:      
 
Domain Number 7 Region: 790-888
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000476
Family Heme-binding PAS domain 0.056
Further Details:      
 
Domain Number 8 Region: 672-791
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000209
Family Flavin-binding PAS domain 0.069
Further Details:      
 
Weak hits

Sequence:  103690.all1716
Domain Number - Region: 594-690
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0248
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 103690.all1716
Sequence length 1333
Comment (Nostoc sp)
Sequence
MTEILSRTTQMPVSEVQEGMAVEPNHVYVIPPNTRMTIAQGVLKLIPLEKIRGVSMTVDS
FLISLAEDRGNRAIGVILSGGDSDGARGLETIKAAGGITFAQCEESAKVSSMPNTAVASG
HVDFILTPQKIAEELANISSHPYVNHPTPSKQVDIMPEGTDSLSIIFSLLRAATGVDFTY
YKQTTLKRRIQRRMMLYKLEKLEDYAQYLQNNQAEVLALYQDLLIKVTGFFRDPEAFEAL
KTNVFPIITKNRTPDSPIRIWVAGCSTGEEAYSMAICLLEFLADKVANTPINIFATDINE
VAIEKARIGVYKPSEVADVSPERLQRFFVQVEGGYQISKPVRELCIFARQNLISDPPFSR
LDLITCRNVLIYLGATVQKKLLPIFHYGLKSTGFLMLGTSETVGEFFDLFNLVDRKNKIY
SRKIAPARLGIDFISQNYPLEAFNPQPKINEDVLNNQEMQKEADRIVLNQYAPVGVIVND
DLEILQFRGQTSSYLQPAPGRPSFNLLKMAKEELRLELRTAIHQAKKQEMSVRKEGIELR
EGEQVRQVRIDAIPFQLTAGGERYFLVLFEDMPPSVTAAPQAASKNPNVSSRQRQQMNDE
QEINRLGQELATTKEYLQSIIEEQQATNQDLRAANEEILSSNEELQSTNEELETAKEEIQ
ATNEELNTINEELQRRNVESNQVSNDLQNLLSSINIPILMLGGDMRIRRFTPTAGRIFNL
IVTDIGRPLSDINHKLTIPDLEAQILEVVGTLNLKTQEVQDNDGHWYDLRIRPYRTIDHK
IDGAVVVLVDIDALKRSTEELRASKDYAEAIVATIRESLVILDIDLQVITANQFFYEKFQ
VTPEETEHHLIYEIGDGQWNIPQLRSLLEDVLPQQTQFQNLEVEHNFERIGQKIMRLNAR
KMTLLDNRRMILLVIEDITQQKQLEAERTHLLAQEQSARNAAEAANHAKDEFLSILSHEL
RNPLNSMLGWANLLRTHQLEEVTVNQGLEAIERSAQAQNHLISDLLDVSRISSGRLRMDA
QEVELIPVIEAAIAVVRLAAEAKNIQIETKLDPTHTPMLGDPIRLQQVIWNLLSNAIKFT
PTKGRIDVTLEYTYFQAQIQVKDTGAGIKADFLPYVFERFRQADGTRTRSNQGLGLGLSI
VRHLVELHGGTVEVESQGEGQGSTFTIKLPVQANRKENPVATVQEPVTLTNVPEIPTDNL
PSLEGVRVLIVDDEPDIRLLFKLVLEEYGVKVTEVASAREALSKLRENPGCYDILLSDIG
LPEEDGYLLMRQVRALSAEEGGQIPAAALTAYAGDSEYTQALAAGFQTHIAKPIEPYQLV
SLVASLAGRVRGV
Download sequence
Identical sequences Q8YW99
gi|17229208|ref|NP_485756.1| 103690.all1716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]