SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI102249 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI102249
Domain Number 1 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000244
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI102249
Sequence length 385
Comment (Postia placenta MAD 698)
Sequence
MSSTLSFLDQFNAPSTEGGKRLSIYTPKHTHVGDSTLLTLLLSNPTDVFNKLKAHNPEAT
NATDRAALEAYLSARREYDEAVKAADEAIDHHKRLLRQRDDHVLTELIRLDNLKVAHRFQ
PLLPRSIRARHNKFIPRAIPNAYLPLPAPLPTSAFRRPPIPSPFLQATPRSTTIPTDWQP
NPGWTPKGSCRRCGSSRHWVRDCPDVRCAGCGKEAPGHLERECGTRPMKRHVSAPPEEPA
RRVGVVVDNVFLEGIINEAKERKEKERQTKAIPIPPPRSANPEPPTSPVAGPSRPRPDTP
VVFRKVDPDWTPDTTQWTWDSSWPNQKHLSGEEWMNVGRNARKEWFDEEEDDGVDWELYG
DGEHLHNGVHAHFVPGIVPLRFFLH
Download sequence
Identical sequences B8PKG6
XP_002476170.1.31404 jgi|Pospl1|102249|fgenesh3_pg.194__2 104341.JGI102249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]