SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI106043 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI106043
Domain Number - Region: 29-64
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00192
Family Retrovirus zinc finger-like domains 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI106043
Sequence length 279
Comment (Postia placenta MAD 698)
Sequence
MTRLELKWQVTTGSIIGSNLAATSSATAFVTKSHGNSSKPRKTCSNCNMTGHEIADCFQL
GGAMEGKCAEVLTTKCPCLDKGKSGGSKVLHDPDGRMFMLSNTGDTMYIDTTASMASSSA
AKAPSTKFASLTVDTPDPVDLWAFPTLSPADTFKYSTLTRSLTDEDTASVDWGHHSSTAS
VTALATAAPAAAAALGTAPFFFDFSASTHLSPCKDNFSDLVAIAPHGIRGINGSVIYMHG
VSTIVLAIPIIALSLTWLRPTFYQGVNELCNSWDWCMWT
Download sequence
Identical sequences A0A1X6MJ47 B8PLE2
104341.JGI106043 jgi|Pospl1|106043|fgenesh3_pg.220__10 XP_002476493.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]