SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI92128 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI92128
Domain Number 1 Region: 382-435
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000497
Family Pentapeptide repeats 0.0094
Further Details:      
 
Domain Number 2 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000384
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI92128
Sequence length 446
Comment (Postia placenta MAD 698)
Sequence
MSSTLPFLDQFNAPSTKGGKRISIYTPKHTHVGDSTLLTLLLKNPTDVFNKLKAHNPEAT
NATDRAALEVYLSACRDYDEAVKAADEAIDHHKRLLCQQDDRVLTELIRLNNLKVAHRFQ
PLLSRSIRARHNKFILCAIPNAYLPLPAPLPTSAFRRPLIPSPFLQAMPRSTTIPADWQP
NPGWTPKGSCRRCGSSRHWVRDCPDVQCAGCGKEAPGHLERECGTRPMKRHVSAPPEEPA
RRVGVVVDNVFLEGIINEAKERKEKERQTKAVPIPSPRSANPEPPPSPVAGPSRPRPDTP
VVFRKVDPDWTPDTILWTWDSSWPNQKHLSGKEWMNVGRNTRKEWFDEEEDDGVDWELYG
DGEQAAEAGLYTGEDKGRLCALVHAQLVHAQLVHAQLVHAQLVHAQLVHAQLVHAQLVHA
QLVCAQLVCAQLVRVQHADAALGARK
Download sequence
Identical sequences B8PDB2
jgi|Pospl1|92128|fgenesh3_pg.89__29 XP_002473660.1.31404 104341.JGI92128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]