SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI93607 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI93607
Domain Number 1 Region: 570-601
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000366
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI93607
Sequence length 642
Comment (Postia placenta MAD 698)
Sequence
MRARTRGANGCAWPSTNHNFLRCYAPGNIIFLRRDLRELWETNRLLIIPHPDHLQKLKYC
PVSGTISSRKTCWWCSGRLLNFWPARDIIRWRWAFSSCHPNDRTQYCSPLLDDETVRFCR
QFRPILLGIKRRCFGDTSASSQDYIGDAEREVGIRPPAEFEDAEMLAYRQEQAGDVQPVV
QKCIPLQYPWFSGYRLQKHRSNPKFDLVIHSSLCSSLLGVVVVDFWSTWFLWDYQLSQDH
CSSSTTEQISASSPPPKGLPYTLKAAPGVAPPVQTRRSSPIKNSLATTRDTHPLTQKTYS
PSYGSTSNLRKQQKVHSHPSTNNHSNSLKFTPPAPTNAPVEVPMAMFTQEDINQRIAVTL
TAYQSQQSTANRPLHLDIPAPEPFSGKAEDLRRFIQCILSYFVATNNTRLSDEAKIAFTV
ALMRKDLGKTWADTYYEKSAGGVQVYSTWADFVAALEEVFPEHGTRIKAHQILMKLPERQ
KDRKTALSLGNYVTRFEQLASKAQLKDTEVNGTNCIENDYHTLHANFGALVITDTRDYGE
PMDIDAAAVASTFASTSGGRKWELGAVLNKADQKLHRDGNLCFYCHIKGHSAKDCRKKAA
ARQGGGRPNQGGSGKDDFCARIKTLSADEKRELYEELMMEDF
Download sequence
Identical sequences A0A1X6N5D2 B8PI38
jgi|Pospl1|93607|fgenesh3_pg.148__21 104341.JGI93607 XP_002475338.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]