SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 106370.Francci3_1351 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  106370.Francci3_1351
Domain Number 1 Region: 80-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000248
Family NfeD domain-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 106370.Francci3_1351
Sequence length 144
Comment (Frankia CcI3)
Sequence
MSDGTIWIVIAGALVVGELLTLDLTLAMFALAALIGAGVALLGVDLVWQIVAFVVAAGGF
GLGLRPVAKRQLQRTPPLLTGADALVGERAMVVERVDGGGGRVKIKGEIWSARSYPTTTV
LEAGSEARVLRIDGATAIVHSFEL
Download sequence
Identical sequences A0A062X728 A0A1X1MK51 Q2JDB4 W9D0W1
106370.Francci3_1351 gi|86740057|ref|YP_480457.1| WP_011435794.1.33095 WP_011435794.1.51677 WP_011435794.1.5445 WP_011435794.1.61086 WP_011435794.1.64980 WP_011435794.1.72223 WP_011435794.1.79022 WP_011435794.1.98991 WP_011435794.1.9943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]