SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1140.Synpcc7942_1138 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1140.Synpcc7942_1138
Domain Number 1 Region: 26-249
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.28e-57
Family PP-loop ATPase 0.00024
Further Details:      
 
Domain Number 2 Region: 227-329
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 2.62e-20
Family MesJ substrate recognition domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1140.Synpcc7942_1138
Sequence length 336
Comment (Synechococcus elongatus PCC 7942)
Sequence
MLHRPLPSPSALSSDCWTPFHARLHQLLQRRSLLPTRSRLLLAVSGGQDSLALVQLLRGL
QPHWHWSLAIAHCDHGWRSDSTANAEHLRQLADQWQLPFYCQRSPEPPRSEAAARTWRYQ
VLEAIAADIDAALLVTGHTASDRAETLLYNLTRGSHLQGLASLRWQRSLSDRLTLVRPFL
GFTRAETSKMVQQFQLPVWEDSTNRDRRFARNRLRLEVLPQLRQINPQCDRHLANTAELL
ADEADWLAELTEQVYQQSLSEKGLCRSQLAQQPIALQRRVLHAFLQDQLQRSPSTVQVEE
LRQLITAPQGSCSSSLPQRRVAVVAGDWLRLQSVDD
Download sequence
Identical sequences Q31P51
gi|81299947|ref|YP_400155.1| 1140.Synpcc7942_1138 WP_011377878.1.45845 WP_011377878.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]