SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1148.sll0547 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1148.sll0547
Domain Number 1 Region: 4-51
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000785
Family GSPII protein E N-terminal domain-like 0.03
Further Details:      
 
Domain Number 2 Region: 68-120
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000222
Family GSPII protein E N-terminal domain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1148.sll0547
Sequence length 220
Comment (Synechocystis PCC6803)
Sequence
MVSSQKPIGIILQEAKLITPGQLEVALYEQKQFQMLLGEILSHHGWISQETADFFVDLWP
AMVGQPVQGPIGYYLKMAHLLDEDQIERILREQRRLGVRFGSVAVLKGWLKEETINFFVK
NIVREAQEDTPSAALVLPVPQLPISPVSPLKTPRWRSPELVEAQAKETYELLSNEKGENL
PPIIPASLRKDTDSPRQAAETLILFDDHHQSQGKEDGESD
Download sequence
Identical sequences L8APK3 Q55396
1148.sll0547 gi|16331688|ref|NP_442416.1| gi|16331688|ref|NP_442416.1| gi|383323430|ref|YP_005384284.1| gi|383492483|ref|YP_005410160.1| WP_010873713.1.11876 WP_010873713.1.1889 WP_010873713.1.18904 WP_010873713.1.33690 WP_010873713.1.35395 WP_010873713.1.47586 WP_010873713.1.99424 gi|383326599|ref|YP_005387453.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]