SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1148.sll0670 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1148.sll0670
Domain Number 1 Region: 53-167
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 4.97e-34
Family L,D-transpeptidase catalytic domain-like 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1148.sll0670
Sequence length 169
Comment (Synechocystis PCC6803)
Sequence
MLWPLVRYWGSGLMIAGICLTQLIGVDLFIPMVSAQTYQDTLNQKMAILKKSEERWIEVN
LSTQRLIAWEGNKPVYAIIISTGKKGTPTIPGIFTIQSKRSIDRMRGADYDIDDVPYAQY
YSGGYAIHGAYWHNKFGTPVSHGCINLAVDHAKWLFNWSEISTPLVIHY
Download sequence
Identical sequences Q55969
gi|383323690|ref|YP_005384544.1| gi|383326859|ref|YP_005387713.1| gi|16331947|ref|NP_442675.1| gi|383492743|ref|YP_005410420.1| gi|16331947|ref|NP_442675.1| 1148.sll0670 WP_010873970.1.11876 WP_010873970.1.1889 WP_010873970.1.18904 WP_010873970.1.33690 WP_010873970.1.35395 WP_010873970.1.47586 WP_010873970.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]