SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1148.slr0346 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1148.slr0346
Domain Number 1 Region: 6-160
Classification Level Classification E-value
Superfamily RNase III domain-like 3.66e-36
Family RNase III catalytic domain-like 0.00086
Further Details:      
 
Domain Number 2 Region: 118-232
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.29e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1148.slr0346
Sequence length 244
Comment (Synechocystis PCC6803)
Sequence
MSLLPHRQTQLKALLRRLGLTDNTPVDWNLVDLALTHASQSPEQNYQQLEFVGDAVVRLA
SAEVLMKHYPQTSVGEMSALRAILVSDRTLAGWGELYGLDRFLWITPAVLADKNGRVSLM
ADSFEALLGALYLSVGDLSLIRPWLSEHLLAKATEIRQDPALHNYKEALQAWTQAHYKCL
PEYRVEPLDQNLPQQSGFQATVWLGDQPLGSGSGSSKKSAEQAAAQQAYQDFIAKEILPM
PKIN
Download sequence
Identical sequences L8ASV9 Q55637
WP_010873382.1.11876 WP_010873382.1.1889 WP_010873382.1.18904 WP_010873382.1.33690 WP_010873382.1.35395 WP_010873382.1.47586 WP_010873382.1.99424 gi|383326265|ref|YP_005387118.1| 1148.slr0346 gi|16331355|ref|NP_442083.1| gi|383323096|ref|YP_005383949.1| gi|16331355|ref|NP_442083.1| gi|383492149|ref|YP_005409825.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]