SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002427130 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002427130
Domain Number 1 Region: 89-487
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.66e-105
Family GABA-aminotransferase-like 0.0000000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002427130
Sequence length 542
Comment (Pediculus humanus corporis)
Sequence
MSCPFLNCFSKTFVKRYGTILSANFEKYCPVVGSYYCTLPSEKKVEKNPVQKCPFLANST
QSKIIKEANEECQEDLILKKKEISIKSSFDYEQFFHSQILKKKQDHSYRVFKKVNRLAQS
FPSALEYTGKKKTVTVWCSNDYLGMSRHPQVIAAVKKALENHGTGAGGTRNISGNSLFHE
NLEEEISRLHQKESALLFTSCFVANDSTLFTLAKALPGCHVFSDAGNHASMIQGIRNSRV
PKHIYRHNDADHLNEMLSTVDREIPKIVAFETVHSMTGAVCPLKKLCDVSHKHGALVFVD
EVHAVGLYGEHGAGIGERDNQLNNMDIISGTLGKAFGNIGGYIAGSKHLIDMIRSYAAGF
IFTTSLPPAVLAGARESIKILRSYEGAVLREMHQQNVRLLRNKLQEAGLPLEHTPSHIIP
IRLGNAEKCTLVSDILLRDYGHYVQAINYPTVPVGQEKLRLAPTPFHTKQMIEILVRDMI
SVFKKLNIPTFSNNNICPNECSYCKKPLLFKKQESKINNYSNLNNCCELPNCPQIQKIPA
SI
Download sequence
Identical sequences E0VLY6
121224.XP_002427130 XP_002427130.1.24195 vb|PHUM297900-PA|EEB14392.1|5-aminolevulinate

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]