SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 123214.PERMA_0068 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  123214.PERMA_0068
Domain Number 1 Region: 1-289
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.06e-107
Family Methylenetetrahydrofolate reductase 0.0000000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 123214.PERMA_0068
Sequence length 293
Comment (Persephonella marina EX H1)
Sequence
MKIGEILKHINTSISFEFFPPKTPEGEDQLFRTIKDLEKLNPTFVSVTYGAGGSTRERTI
RVVKRIHEQCNLTVMAHLTCIGHSKKEIYDILKGYKDIGIQNILALRGDIPQGQEESFVF
PPDGCRYANELVSFIREQFGDYFSIGVAAYPEGHPESPSLEKDIYYFKKKVEAGAEFAIT
QMFFDNSYFYRYMDLLSKEGINIPVIPGIMPITNFRQIEKFAVMCGATIPKDLVEKLEKV
ENSPEEVAKIGIDYATEQCEDLLKNGVKGLHFYTLNKSKATVEIYRRIKDLIK
Download sequence
Identical sequences C0QT51
123214.PERMA_0068 WP_012676291.1.53201 gi|225849632|ref|YP_002729866.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]