SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 123214.PERMA_0895 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  123214.PERMA_0895
Domain Number 1 Region: 8-152
Classification Level Classification E-value
Superfamily PEBP-like 1.1e-46
Family Prokaryotic PEBP-like proteins 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 123214.PERMA_0895
Sequence length 154
Comment (Persephonella marina EX H1)
Sequence
MEPIIVKSMSFDEGEPIPVDYTCDGMDISPEIVWDNVPEETKSFVLIMEDPDAPMGVFTH
WVVYDIPSSLRLLPENFPKVPQIDGIKQGINDFGRIGYGGPCPPRGSTHRYVFNVYAISV
VSLELPTGATKKIVEERMEGKILSKGKLTGIYGR
Download sequence
Identical sequences C0QPT6
123214.PERMA_0895 gi|225850448|ref|YP_002730682.1| WP_012676520.1.53201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]