SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN17798 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN17798
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily PapD-like 2.88e-27
Family MSP-like 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN17798
Sequence length 107
Comment (Caenorhabditis brenneri)
Sequence
MINVDPPTGNFASSGGSSTHNIVSESESRLAFKVKSSNNEHYRVRPVYGFIDAKGKAKLD
INRLPGPPKEDKIVIQYAEVPAEETDPQAPFKAQAQQGEVIVKLVAA
Download sequence
Identical sequences G0PMI2
135651.CBN15411 135651.CBN17798 CBN15411 CBN17798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]