SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN21927 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN21927
Domain Number 1 Region: 88-111
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000283
Family CCCH zinc finger 0.0049
Further Details:      
 
Domain Number 2 Region: 253-276
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000576
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number 3 Region: 207-238
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000544
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 
Weak hits

Sequence:  135651.CBN21927
Domain Number - Region: 167-191
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00204
Family CCCH zinc finger 0.0044
Further Details:      
 
Domain Number - Region: 142-167
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00251
Family CCCH zinc finger 0.0068
Further Details:      
 
Domain Number - Region: 61-83
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0487
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN21927
Sequence length 312
Comment (Caenorhabditis brenneri)
Sequence
MIVVAQHIPDVQLKAMQKAYAPQTMTDIVSHITAPMTDVEEALFNQKGMKEAPFRDLDRS
GRAVCRKNKIGCCPFGPTCPLRHIDGEKAVVCKHWLRGLCKKGDQCEFLHEYDLTKMPEC
FFFSKYSACSNRECPFRHIDPETKMKDCPWYDRGFCRHGPYCKHRHRRRAVCPNYLAGFC
PQGRECQHAHPSFGLPSFENIAISHAKPSYSQAITCHNCHERGHKATTCPHLPGQNRQSQ
DHHHRVDLSLIPDKKNLSDVTCYKCGEKGHYANRCHKGALAFLSNTAHLAHEQREKDEKE
QGRINNMLRPAA
Download sequence
Identical sequences G0PAE9
135651.CBN21927 135651.CBN24449 CBN21927 CBN24449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]