SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000001350 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000001350
Domain Number 1 Region: 122-155
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000628
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000001350
Domain Number - Region: 100-207
Classification Level Classification E-value
Superfamily HydA/Nqo6-like 0.000392
Family Nickel-iron hydrogenase, small subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000001350
Sequence length 240
Comment (Monodelphis domestica)
Sequence
MSLLSAIDTSAASVYQPAQLLNWVYLSLQDTHQASAFDAFRPEPAGASHPELGYGKGSPE
QLGSPLNSSYLNSFLQLQRGEALSSSLYKSASPYGSLNNIVDGLSSLTEHFSDLSLSSEA
RKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWMS
GNSWANMGQECIKCHINVYPHKQRPLEKPDGLDVSDQSKEHPQHLCEKCKVLGYYCRRVQ
Download sequence
Identical sequences F7D4T0
XP_001364902.1.35504 XP_020861728.1.61212 13616.ENSMODP00000001350 ENSMODP00000001350 ENSMODP00000001350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]