SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000001882 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000001882
Domain Number 1 Region: 147-352
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-38
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 364-555
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-37
Family Laminin G-like module 0.0068
Further Details:      
 
Domain Number 3 Region: 559-739
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-37
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 4 Region: 4-130
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-22
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 5 Region: 765-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000223
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000001882
Sequence length 803
Comment (Monodelphis domestica)
Sequence
MLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQHS
GIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKE
VVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKK
TGSISFDFRTTEPNGLILFSHGKPRHQKDAKNPQMVKVDFFAIEMLDGHLYLLLDMGSGT
IKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDDLYLGGLPE
NKAGLIFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQSTAGVKPSCSRETAKPC
LSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATILSYDGSMFMKIQLPVVMHTEAE
DVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFA
GYNLNDNEWHTVRVVRRGKSLKLMVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSS
VPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKSSYVALAT
LQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSN
KPLNDNQWHNVMISRDTNNLHTVKIDTKITTQSTAGARNLDLKSDLYIGGVAKEMYKSLP
KLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGCEGPSTTCQEDSCSNQGVCLQ
QWDGFSCDCSMTSFSGPLCNDRE
Download sequence
Identical sequences F7EM76
ENSMODP00000001882 ENSMODP00000001882 13616.ENSMODP00000001882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]