SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000005098 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000005098
Domain Number 1 Region: 3875-4069
Classification Level Classification E-value
Superfamily Fibronectin type III 1.47e-37
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 2 Region: 4271-4447
Classification Level Classification E-value
Superfamily Fibronectin type III 1.75e-36
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 3 Region: 4446-4635
Classification Level Classification E-value
Superfamily Fibronectin type III 7.06e-33
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 4 Region: 1519-1695
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-32
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 5 Region: 4735-4935
Classification Level Classification E-value
Superfamily Fibronectin type III 2.74e-32
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 6 Region: 3511-3684
Classification Level Classification E-value
Superfamily Fibronectin type III 3.23e-31
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 7 Region: 1053-1243
Classification Level Classification E-value
Superfamily Fibronectin type III 7.1e-31
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 8 Region: 2140-2327
Classification Level Classification E-value
Superfamily Fibronectin type III 7.93e-31
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 9 Region: 2619-2800
Classification Level Classification E-value
Superfamily Fibronectin type III 5.88e-29
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 10 Region: 4083-4266
Classification Level Classification E-value
Superfamily Fibronectin type III 7.22e-29
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 11 Region: 2466-2622
Classification Level Classification E-value
Superfamily Fibronectin type III 1.77e-28
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 12 Region: 2820-3020
Classification Level Classification E-value
Superfamily Fibronectin type III 2.03e-28
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 13 Region: 1711-1895
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.96e-28
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 14 Region: 1898-2054
Classification Level Classification E-value
Superfamily Fibronectin type III 5.04e-26
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 15 Region: 2330-2527
Classification Level Classification E-value
Superfamily Fibronectin type III 1.85e-25
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 16 Region: 1247-1288,1319-1401
Classification Level Classification E-value
Superfamily Fibronectin type III 1.39e-23
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 17 Region: 3691-3870
Classification Level Classification E-value
Superfamily Fibronectin type III 3.61e-23
Family Fibronectin type III 0.0063
Further Details:      
 
Domain Number 18 Region: 3020-3153
Classification Level Classification E-value
Superfamily Fibronectin type III 2.85e-22
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 19 Region: 2013-2137
Classification Level Classification E-value
Superfamily Fibronectin type III 3.26e-22
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 20 Region: 121-293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000178
Family Pentraxin (pentaxin) 0.051
Further Details:      
 
Domain Number 21 Region: 4655-4739
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000122
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 22 Region: 1424-1505
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000313
Family Fibronectin type III 0.0079
Further Details:      
 
Domain Number 23 Region: 641-691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000229
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 24 Region: 847-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000257
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 25 Region: 795-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 26 Region: 3450-3513
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000524
Family Fibronectin type III 0.0044
Further Details:      
 
Domain Number 27 Region: 747-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 28 Region: 900-942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 29 Region: 694-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 30 Region: 1002-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000159
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 31 Region: 575-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000297
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 32 Region: 951-994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000558
Family Laminin-type module 0.013
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000005098
Domain Number - Region: 518-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000347
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 338-415
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0374
Family APC10-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000005098
Sequence length 5205
Comment (Monodelphis domestica)
Sequence
MNYLAHSWDYRFLFHVIGTLILAYFASIPLASSQGLFPRLQNVGALKNVSIVPTQATCGL
PGRSAFCHSSIAAESIQYCTQRFCIQDCPYRSSSPSYIALFSEGLRSCITTDKNDLHPDS
PSNSTSFIFGNLKDCFSLPHSPRLATSFALAVWLKPEQEGVMCVIEKAVDGQIVFKLTIS
EKETMFYYRTVNGLQPPIKVMTLGRILVKKWIHLSVQVHHTKISFFINGLEDDHTAFDVR
TLHGPVTDLAPGAVRIGQSSKGSEQFIGRMQDFRLYQVALPNRDILEIFSGELLYLHTQS
ECRCPVSHPRVHPLVQRYCLPNDADDTTNDRVLRLNSEAHPLSYINDNDIGTSWISHVFK
NMTELENGVAITIDLENGQYQVFYIVLQFFSPQPTGIQIQRKKMNHLDWEDWQYFARNCS
DFGMKNNDRLENPDSVNCLQLPNFTPYSRGNVTFSILTPEPNRRPGYNNFYKTPSLQEFV
KATQIRIHLFGQYYTTESSVNFRHRYYGVDEITISGRCNCHGHANDCDMISKPYRCFCSQ
ESYTEGRHCDRCLPLYNDKPFHQGDQVHAFNCKPCQCNNHSRSCHYDKTMDPFPAEYYRG
GGGVCDNCQHNTTGRNCELCKDYLFRQVGADPSARDICKPCDCYEVGTKNGSLLCDQIGG
QCNCKRHVSGRQCNQCQDGFYNLQELAPDGCSPCNCNTSGTVDGDITCHQNSGQCKCKGN
VIGLKCDRCNFGFKILRSFNKDGCEPCHCNLYGSVNKFCNPLSGQCKCKKDAKGLQCDAC
VENFYGLDIDGCKLCDCNTEGTLSGTVCDAKTGQCTCKPNVGGRRCDECLDGYYQLRQNN
SFFCLPCNCNKAGTVNDSLLCDKSTGQCPCKAGVRGLQCNHCEPHRYNLTISNLQGCQMC
ECDSLGTLADAVCDQISGQCPCLPNHQGRQCNQCKPGFYVSPGNKTGCLPCSCHTAGAVH
QVCNSLTGQCICQGASIIGQRCDHCKDHYFGFDPLAGRCQPCNCHLPGALNGSCHLVTGQ
CFCKQFVTGLKCDDCVPGASHLDIHNLFGCSKTPSQQPPPRGQVQSSSTINLSWHPPDSP
NAHWLTYSLFRDGIEIYMTEDKYPYGVHNFTDTALLPYTSYSYHLLTTNVHGSERSATVI
YRTKSGTPEGNLNLHYVFPVSPYSVTLYWTAPLNNSGPIEKYILSCTPLDSIQPCGAYEG
LDTLATIWNLIPFTKYHFSVQACTSGGCLHSLPLIITTAQAPPQGMDPPTVQTISSTELY
IEWHPPEEPNGIIIRYELHMRRLQSNDEQTMTESRVFQYSGWLNPQTVTASANENALTPP
QTTTIITGLEPYTKYEFSVVAVNMAGSVSSDWISERTGESAPVFMPPPSVFPLSPYSLNV
SWMKPENNATRGEIVEYKVNLISEQILHQQPSLEVSQVLYTAEAHEFFYVVRGLKPYRTY
HFTISLCNLIGCVTSDPGMGQTLATAPVHVRAPHVEGINCTVMKISWLPPGELNGPSPIY
LLERRETSLPALDTEMIKGIRFIGNGYYKFPSSTLPINTDFTGIKVNFRTREPDGLIMLA
VSPGNQEEYFALQLKSGRPYFLYDPQGSAVVVTTTNDNGKQYNDGRWHQVTATRHQALGQ
ITVDGHFIGSSSASSGSTIIGENTGVFVGGLPWGYTILRKDIEIIQKGFVGCLKDVFFKK
SHNPFEVWEPLEWQNAEEQMNAYSSWEGCPNALREGAHFLGTGFLEIYPYVFPGGMDFEI
SFKFRTDQMNGLLLFVYNKDGPDFLATELKSGLLSFLLKTSITFTQVDLWLGLSYCDGKW
NKVTVKKAGSVISASLNELMEHVSESSAQPLMVNSPFYVGGIPPLLRDTYKELSLEQGFG
GCMKDVKFTRGAVVNLASVSSSAVRVNLDGCLSTDRAVNCRGNDSILVYQGKEPSVYESG
LQPFTEYLYRVVASNEGGSAESLWSRGRTKGTAPQSVPTPSRAHSINGYSIQVTWDKPVG
VRGIIEKYIVKAYDKNGHHVPAASVEFVNTSALTGILTGLLPFKNYAVTLTACTLAGCTE
STQALNISTPQEAPEEVQPPLAKSLPNTLLLLWNPPKKANGIITQYSLYMDDTLIYTGLR
ENYTVTDLAVFTPHQFLLTACTLVGCTNSSQVTLFTAQLPPDNIDAPILTVLDSRTIYVQ
WKQPEKLNGILERYILYMADHEQNITIWNVIYNNTELFQDHTIRHLLPGTRYLIKLAACT
GGGCKISEISIALTDETVPEGVPAPTAQSYSSDSFNISWTKPEYPNGVLTTYGLYIDGVL
MQNLSCLTYYAHGFAPWSLHSFRVQACTAKGCALGPLVENRTNEAPPEGAVTVFVILEGP
REVKLKWEAPLSPNGRLTYAVFFTGLFYVEQVKYNYSLLNDTQILYHTEEANLWVPISGL
VPFSNYTVEVNASNSQGSVISDPITIKMPPGAPDGVLPPRLSSATPTSLQVVWSTPVRNN
APGSPSYRLQMRPSHSMDGILDLFSDPSASVSYVIGDLQPFTTYELRLIASNEYGSTYSD
WTSLVTTEDKPGPIDPPFLLDVSPRTMTLKWQHPSRPNGVITHYNIYKNGHFHSKLSGKI
SNSTMLNLHPNASYHFQLEGCTSKGCSLSPETRTVWTLPDAPEDIPNPELYSDTPTSVSI
SWKLPLFPNGQLENFTIQRKSKGMEQVTTLVTLPLNHSMKFVDQTSALSPWTTYEYRILM
STLNGGTNSSAWVEVTTRPSRPAGVQPPEVLVLGPDMAKIIWSPPLIPNGNILSYEVCMP
DPRIRVTPSGSNTSLLSQIMSHLIPFTNYSVTIVACSGGGGHLGGCTESLPTHIITHPTI
PQGIGTLSVTPVSESYIGVSWQPPSRPNGPHLRYELLRRKIQQPLASNPPEDLNLWRTIY
SGTQRFYEDKGLSRYTTYEYKLIVHNIVGYAPSKEAIVTTLAGLPEKSATLEIQDLNHTA
IRVGWSRPTLKDLQGDVEYYTLIWSSATSNESLKILPDVNCFVIGDLKPNTEYQIFICVF
NGAHSINSEVLHVTTRDGEPQGMLPPEVVIINSTAVRVIWTSPSNPNGVVTEYSVYVNNK
LYKTGMNAPGSFVLGDLSPFTIYDIQVEVCTKYACVKSQGTKITTVEDTPCEIAAPKIHI
ISSRSLQIDWESPAQPNGLILGYELLRKTWYSCTISQKVIGNQNDGFCRIIRCQKPDNIC
GHMCYSPESKVCCNGILYDLKLGYVCCEDNYIPFGPNSSRICCGGRMHEIQPKYQCCSGY
YTRVLPGEICCLDDEYKRVSVGIGDTCCKNIPYSTSGNQICCAGVLHDGYKQQCCGGKVV
SKELVCCGGEEEGSIHISLPEMFCCGQDYVNMSDTICCSASSGESKAHVKKNDPVPIKCC
ETELIPETQECCNGVGYNPLKYVCSDKISAGMMMKEIKECRPASLCPISKKDAAYCGRCD
FNLTSHVCALIRNPQQSPQKLSYEDTCPSAEETVYTGNTSTYSFTDVNLEPYTMYEYRIA
AWNSHGQGFSKVAKTSTKQDVPQGVSPPTWTKMDNREDVIVLNWKKPIQPNGVIIHYIVL
RNGIERFRGTEMSFVDTNGVHPYQEYSYQLRVCTVSGCTDSYQVVAATIQGVPESVLPPK
ITALSAEVLYLSWRVPEKPNGIIREYRIYQSGKGLIHIDNKGKMEHTVTGLCAYTNYSFT
LTACTSVGCTTSQPIVSRTLQAAPQGVWSIPRHIIINSTTVELYWNEPEKPNGLISKYQL
HRNGTVIFLGGREDQNFTDDSLEPKSSYVYQLEVHTGGGSNTSDDYVVQTPESTPEEIYA
PYNVTVVDPYSIFVAWSPSETHVPKVPLQYNVLLNPGSVEPLIYPVGHHHLTVVKNLTPY
TQYEVRIQACQNGDCGVSSGTLVTTFEAAPLDLKPPFLLTMGPTSILIRWLPPTKPNGII
IKYFIYRRTVGIEGESLLFIWSEGSLEFTDASDTLKPFTLYEYRVRAHNSKGSVESPWSS
AQTMEAPPMGMQAPQVQATSAYSVLLNWTKPESPNGIISQYRIIYQERQKDPTFNVPTVT
AFTVMGTRHQAHLFGLEPFTTYHIGIVAVNLVGEVSSPWTTVCTLESSPSGLSNFTVERK
EDGHALLLQWSEPVRTNGVIKAYNIFSDGGLEYTGLSRQFLFRRLEPFTLYVLTLEACTM
AGCTLSTPQALWTAEAPPTSQLAPTIQSVEATSIELSWSEPINPNGKIIHYEVIHRCFKG
YAGGNRTTEADEKIVFTEYNTERNTFAYNDKGLQPWTLYEYKIRTWNSAGHTDSPWSAVK
TKQAPPEGLLPPDLVFESFNPRRLIISWAPPAQPNGIIHSYRLQRNEALYPFNFDAETFN
YTDDELLPYSEYSYAVIACTAEGCSTSQVSTIKTPEAAPALVNPPSLWALTATQINASWS
PPPTPNGEIIRYFLQFDDQEYHAGKNLSGVVSQLQPYTEYEFTLIACTIGGCTASKAKSI
RTMEAPPQSMSSPKVQATGSESVEITWKVPARPNGQITNYEVKRDGEIIYTGMETRYHDL
NLSSGKEYGYTVTATNSQGSTSSPLVKVRTNPSAPSGMAPPELQAWNSQEIKVNWDPPVK
TSGDIINYTLRIWDPVETEAEAIHMNTTHNSFAKRSFMVTQLKPFHRYEIRIQGCTLLGC
ASSDWSSIQTPETSPMLQPPPILDVQMGPRGFQPRVSLQWTGPLQPNGKILYFELYRRQV
TALPGTSSPVLVYNGTLTSFTDSELLPFTEYEYQVWSGNSAGKSPSSWVQCKTGPAPPEG
LQAPKFHAIFSTQAVVNISPPLKPNGIVSLYRLFSNHTRGTENVLSEGMATQQTIHDLEP
FTTYSIGVEACTCFNCCSKGPVAQLTTHPAPPSQQPPPQIQTLTSRTASFQWNPPSSPNG
IVESYELELYIPCPLTAEMPCTPGPTEIKYTGQSQSASIGDLQPYTSYMLRVVAYNMVGS
TASEWISFTTEKEFPQYRAPFSVASNLSVVYINWSGTFLLNGKLKEYVLTDGGQRLYSGL
DTSLYIPRTADRTFLFQVTCTTDEGSVKTPLIQYDTSTGLGPELTTPGEKMGAGSKHAEF
YNELWFIILMATLGLILLAIFLSLILQRKIHKEPYIRERPPLVPLQKRMTPLSVYPPGET
HMGLADTKIPGTGTPMSIRSNRSMSVLRIPSQSQMSRTYSQPSLHRSVSQLMDIQDKKVL
TDDSLWETIMGHDSGLYVDDEDLMNAIKGFSSVTKEHTTFTDTHL
Download sequence
Identical sequences F6UDP9
13616.ENSMODP00000005098 ENSMODP00000005098 ENSMODP00000005098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]