SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000006865 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000006865
Domain Number 1 Region: 130-264
Classification Level Classification E-value
Superfamily Acid proteases 1.83e-41
Family Retroviral protease (retropepsin) 0.0000816
Further Details:      
 
Domain Number 2 Region: 8-139
Classification Level Classification E-value
Superfamily dUTPase-like 3.27e-22
Family dUTPase-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000006865
Sequence length 282
Comment (Monodelphis domestica)
Sequence
EPLSSSLTRATAGSAGLDLCASTTRILTPEEGPIVLPTGKFRPPPPGMFFLVIGRALTTL
QGVIVHPTLVDNDYTGERKIIIESPHGPVTIPAGKRLAQALPLPMIGNFLAITHTQGPSS
PGSSNIYWVQQLTESRPTLQLNIEGKTFTGLLDTGADSTVISQAHWPHSWPLQPSSTHLS
GIGQVQDTLQSSKVPNWQDTEGNSGTTRPYVVAGLPVNLWGRDILAQMRLLMVSPSDPVT
TMMLKSGYLPGKGLGKREQGLPYPISFQPHKNREGLGLQSFS
Download sequence
Identical sequences F7FHD8
ENSMODP00000006865 13616.ENSMODP00000006865 ENSMODP00000006865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]