SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000008493 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000008493
Domain Number 1 Region: 162-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 921-978
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.55e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 218-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 641-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 274-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 530-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 753-810
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 8 Region: 697-754
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 809-866
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 10 Region: 330-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.65e-24
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 386-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 12 Region: 428-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.23e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 13 Region: 865-922
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 14 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 15 Region: 586-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.25e-20
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 16 Region: 963-1015
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 17 Region: 492-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000109
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 18 Region: 125-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000181
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000008493
Sequence length 1019
Comment (Monodelphis domestica)
Sequence
EVVTFKDVAVDFTREEWRLLSPPQKELYKEVMLENARNLLSVGLPAPPEDMITSLEQTED
PWMLEQESLRTCCPGDKSYICVFVTICMFYCFFLLDGEIRPEMKENPTQMSASVEEMELQ
RFEKPSENKECGSTFMPRASLARHQRNYTKEKSYKCKECEKTFTQSSSLIRHLRVHTGEK
PYKCKQCEKTFSQSSCLVAHQRIHTGEKPYECKQCGKTFSQSSNLEVHWRVHTGEKLYEC
KQCGKTFRMSSSLAAHQRIHTGEKPYECKHCGKTFSQSSCLVAHQRIHTGEKPYECKHCG
KTFIQSSCLAAHQRIHTGEKPYECKHCGKTFRTSSRLAAHQRIHTGEKPYECKHCGKTFT
VYSTLLLHERIHNGEKPYECKICGKTFLLSSSLAEHERIHAEEKPYRCNQCGKTFKDKSS
LAKHERIHTGEKPYECKECGKTFRQSSHLAVHQRIHTGEKPYECKQCGKSFSQSSSLFLH
QRIHSRMYTEEKCYEHKKCGKAFHRSSHLAVHQQIHTEEKPYECNQCRKTFSHSSSLAVH
QRIHTGEKLYECKECGKTFTNNSHFAVHQRIHTGEKPYECKECGKTFTRRSHLAGHQRVH
AGERPYECNQCRKTFSHSSLAVHQRVHRGEKLYECNQCGKTFSQRSHLTLHQRIHTGEKP
YQCKQCGKTCSRSSSLAVHERIHTGEKPYQCKQCGKSFTVYSCLVVHQRIHTGEKPYECK
QCGKTFRLSFSLIVHQRIHTGEKPYECKNCGKTFSQRSHLTLHQRIHTGEKPYQCKQCGK
TCSRSASLAVHERIHTGEKPYECKQCGKTFGRNSHLAVHQRIHTGEKPYECKQCGKSFRV
NSSLSSHQRTHTNVKPYECNQCGKTFRLSASLAGHQKLHTGEKTYECKQCGKTFTSKSNL
AAHHTVHTGEKPYECKPCGKTFRLSSSLAIHQRIHTGEKPYECKQCGKKFRLSSSLADHQ
RIHTGEKPYECKQCGKSYFSNSHLAVHHRTHTGEKPYECKQCGKSFICTSNLGRHEKTH
Download sequence
Identical sequences F6Q7L7
ENSMODP00000008493 13616.ENSMODP00000008493 ENSMODP00000008493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]