SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000009760 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000009760
Domain Number 1 Region: 311-434
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 430-560
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-18
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 3 Region: 129-191
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.14e-17
Family TB module/8-cys domain 0.00047
Further Details:      
 
Domain Number 4 Region: 946-1009
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.15e-17
Family TB module/8-cys domain 0.00019
Further Details:      
 
Domain Number 5 Region: 1110-1173
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000837
Family TB module/8-cys domain 0.002
Further Details:      
 
Domain Number 6 Region: 644-766
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000259
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 7 Region: 563-686
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000738
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 75-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 9 Region: 809-864
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000368
Family EGF-type module 0.024
Further Details:      
 
Domain Number 10 Region: 8-96
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000602
Family TB module/8-cys domain 0.0034
Further Details:      
 
Domain Number 11 Region: 1014-1062
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000037
Family EGF-type module 0.011
Further Details:      
 
Domain Number 12 Region: 1053-1103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000561
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 763-805
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000629
Family EGF-type module 0.0048
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000009760
Domain Number - Region: 856-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00706
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000009760
Sequence length 1245
Comment (Monodelphis domestica)
Sequence
GYTDASGFGYCFRQLRDGECASPLPGLRTQEVCCRGAGLAWGVHDCQPCSEHLSSLGQAG
SPDSACPTGFERVNGSCADVDECAEPGRCQHGECANTRGGYTCVCPDGYLLDSSRSSCIX
XXXXXXXXXPCFRVLRAGGCSLPILRNITKQICCCSRVGKAWGHSCQLCPPFGSEGFREI
CPAGPGYHYSASDLRYNTRPLGQEPPRVPISQPRVPPPVTPAPPVWVPTVMPGSPDPSPI
SLPSCLELPTYFPESRPRPRPRPWPQPQPRPEEPLPTVPIQPSPELPERGKEWLVVEIWC
GNSGPEGPVAGGVCQRNPQICGPGRCIPRQGGYTCVCDSGFWLSTHGTHCIDVDECRQIP
RPCAHGRCENSAGSYRCICAPGFRASPQGTECQDVDECTQQPCTNGRCENTPGSFLCVCP
AGYKAAPHGAGCQDVNECAQSPGPCGWGHCENLPGSFRCSCPPGFQGPECEDIDECARDP
PPCGPGRCDNTAGSYHCACPAGYRSHGPGAPCVDVDECQRSPPPCSYGRCENVEGSYLCT
CPTGFRLNAAGQACEDIDECENHVACPGQECVNSPGSFQCRACPTGHRLLQGRCTDVDEC
SSGAPCGLHGHCTNTDGSFRCSCEPGYRLPPGGRSGPCADVNECLEGDFCFPHGECLNTD
GSFACTCAPGYQAGPRGSSCLDVDECRDESLCQGGLCTNTDGSFECACPPGYRASPDLTS
CNDVDECREGGSALCGNQRCENSPGSYRCVRDCDPGYHAGPEGNCDDVDECREYGPALCG
AQRCENTPGSYRCVPFCDPGYQSTPSGGCQDVDECRNRSFCGAHAMCQNLPGSFQCLCDQ
GYEGARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCPTSTDEFDPMTGRCVPPRPP
ASEFSGGSPQLPASPGLPARPPPPPAPPRRPVAPRPGPGPGTGSGRRECYYDTGAPDACD
NILARNVTWRECCCTVGEGWGSGCRIQQCPGPETAEYQSLCPHGRGYLSPPGDPSIRRDV
DECLLFGDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDNDECTDEEEACEGGQCVN
TMGSYHCTCAPPLVLDGSRRRCVTNDSQSLDDNLAVCWQEVGPDLVCSRPRLDRQATYTE
CCCLYGEAWSMDCALCPARDSDDFEALCNVLRPPAYGPARPGGFGIPYEYGPDFGPGYGG
LPYGPELYPPPPAPVPGLGYDPYPPPPGTLPFPGPGSPYGPPPFE
Download sequence
Identical sequences F7ET67
ENSMODP00000009760 13616.ENSMODP00000009760 ENSMODP00000009760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]