SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000013189 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000013189
Domain Number 1 Region: 175-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.76e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 122-176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 385-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-18
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000013189
Sequence length 450
Comment (Monodelphis domestica)
Sequence
VVTFKDVAMEFTREEWCLLSPPQKELYKEVMLENARNLLSIGKKLSLCCPNILSYLEQRE
APWMLEQEGLRVTVLKVLPLSNSVFTPRRVNWIKTFIRITPKHLKKWSSLFSLWGLKSSC
SQGHSLAEHQRRHTGEKPYECKQCGKTFSQRCKLAKHQRIHTGEKPYECKQCGKTFIKNS
FLAQHQRIHTGEKPYECKQCGKTFSQRCNLAKHERVHTGEKPFECKQCGKTFSHGHVLAQ
HQRIHTGEKPYECKQCGKTFSRGHSLAQHQRRHTGEKPYECKQCGKTFSQRCNLAKHQRI
HTGEKPYECKQCGKTFSQRCNLDKHQRVHTGEKPHECKQCGKTFSHCHSLAQHQRIHTGE
KPYECKQCGKTFSRGHSLGLHQRRHTGEKPYECKQCGKTFSHRCNLAKHQRIHTGEKPYE
CKQCGKTFSQRCNLAKHQSRHTGEKPFECK
Download sequence
Identical sequences F7DQI3
ENSMODP00000013189 ENSMODP00000013189 13616.ENSMODP00000013189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]