SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000018737 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000018737
Domain Number 1 Region: 24-209
Classification Level Classification E-value
Superfamily L domain-like 6.23e-27
Family Leucine rich effector protein YopM 0.032
Further Details:      
 
Domain Number 2 Region: 572-672
Classification Level Classification E-value
Superfamily DEATH domain 8.83e-22
Family DEATH domain, DD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000018737
Sequence length 683
Comment (Monodelphis domestica)
Sequence
LLASNKLNLELYPGGCGLLLRLLGQETAANLQRVQFLRLNCHEEQVEAALALLPRLEHLR
SLVLKVSWERGHLRDDGGSCLRGALTTLPPSLSALAHLVHLDLSFNSLRVLPACIPEMRA
LQALLLSHNLLEGLPEALGALQGLTFLSVSSNCLRALPTGVARLSALQRLDLSENLLESV
PEEIGALSGLTELSLASNLLQSLPDSLGEGPSGAPNLQQAGLMPWPVLLPLVALGASSPP
PPGRSPGSFLPPLHLPVPHYNLTPAMSPKADGTGNVQETHPACVDEFAGRDGISKDLQED
LEHAISTLLCVSQDKPPFIGPVTVQLTLPPSITSMSLDRARIHLLHGDPGVPAWSDITAQ
VALDLTYLYARLQITHFSWYWLWYTTKSCVEGLARKVYDRLRLYRVNFIALQRRRDPEQV
LLQCLPGRKVEPTLKRLQPRYRGPEPSDTVELFEGERFFAAFEQGIAVEADRPDCVAGRI
AFVFYSHLKNVKEVYVTSTVDRKTQAVKGQVSFYRGAVPDAVPEEAVRRRKAPDPLWFPP
FPINFLLTGGGGGEGQGPLKGLTLASLNLGDAESGFLTQSNLVTVARRLGPDWQSVALHL
GLSYPEVQRIQYAHRDDLDGQVRNMLFSWAERQIGHPGSIQQLLEALEQSDRRDVAEEVQ
AILELGRSKYRESIRRVGLAAEE
Download sequence
Identical sequences H9H6Q8
ENSMODP00000018737 ENSMODP00000018737 13616.ENSMODP00000018737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]