SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000019466 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000019466
Domain Number 1 Region: 113-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-16
Family Classic zinc finger, C2H2 0.00029
Further Details:      
 
Domain Number 2 Region: 347-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000031
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 3 Region: 166-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000358
Family Classic zinc finger, C2H2 0.0016
Further Details:      
 
Domain Number 4 Region: 256-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000707
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 5 Region: 410-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000281
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000019466
Sequence length 540
Comment (Monodelphis domestica)
Sequence
TRIHCATEDSNFQDTSTGHDSQSEAFSSSSRKLVSGGRTSIRKPTYWLEMRGIKAASQPQ
GEVTGGVTGKGKRKTSGEEDEDYEEFPQKKQKLSGKKQRPRAPHSPRTQSRYIRKDPPSY
PAGILEEQWYLEILDKGRVSCPTCRAVVRKTVEGLKKHMGNCRQEMYTCHHCGKQLRSLA
GMKYHVMADHNNLPILKDGGELDEPNERERLRKVLKRMGKLKCTRESCSGSFTSIMGYLY
HIRKCGKEAAELEKMTLKCHHCGKAYGSKAGLMYHLRSEHGPMPFFPESGRPEGLRELSL
ETGTGGRVQRRSAKVAVYYLQELANAELAKEWPKKKVLQDLVPDDRKLKYTRPGLPTFSQ
EVLYKWKSEIKMYHRVHCPNQGCESVYSSVSGLKAHLGTCTLGDFVAGKYKCLLCEKEFV
SESGVKYHINSVHAEDWFMVNTNTTKSFEKLMKMQHRQEEQRRWQQHKKRRSPRASRKQQ
RPPEAAPDKKEPDRRGGKGLAGSVSCENGEGEELEPEQVPMPVCFQTVKLSKTSHKRGRK
Download sequence
Identical sequences F6Z679
13616.ENSMODP00000019466 ENSMODP00000019466 ENSMODP00000019466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]