SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000019732 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000019732
Domain Number 1 Region: 38-351
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.77e-62
Family Crotonase-like 0.00012
Further Details:      
 
Domain Number 2 Region: 363-543
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.2e-50
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.000067
Further Details:      
 
Domain Number 3 Region: 543-644
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.19e-25
Family HCDH C-domain-like 0.00073
Further Details:      
 
Domain Number 4 Region: 669-762
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.19e-21
Family HCDH C-domain-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000019732
Sequence length 763
Comment (Monodelphis domestica)
Sequence
MVASRAIGSLSRLTASRARRFTGYACRNFAQSPAVLTRTHVDYAIKGDVAVVRLNSPNSK
VNTLNKELTSDFVKVMNEIWTSDTVKSAVIISSKPGCFIAGADINMIAACKTAQEVTQLS
REGQQMLEKLEKSPKPIVAAISGSCLGGGLELAIACQYRIATKDKKTVLGTPEVLLGILP
GAGGTQRLPKMVGIPAAFDMMLTGRNIRADRAKRMGLVDQLVDPLGPGLKLPEDRTVEYL
EEIAIIFAKGLADKKISGKKEKGLIDMVTTYVMTIPFVRQQIYKKVEEKVQKQTKGLYPA
PLKIIDVVKTGIEHGNEAGYLSESQKFGELAMTKESKALVGLYHGQVLCKKNKFGTPQKA
VMQICVLGAGLMGAGIAQVSVDKGIKTILKDTSIAGLGRGQQQIFKGLDDKVKKKAITSF
ERDSIYSNMTGQLDYQGFEKADMVIEAVFEDIQLKHAVLKEVESVVPSHCIFASNTSALP
IGEIASVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTIASAVSVGLKQGKVIIVVK
DGPGFYTTRCLTPMMSEVIRILQEGVEPKKLDSLTTNMGFPVGAATLVDEVGVDVALHVS
TALTKAFGERFGGGNIELLRQMVNRGFLGRKSGKGFYIYQEGVKSRSLNSAMNEILSNMK
VSAPAEVCTPEEIQYRVLTRFVNEAVMCLQEGILASPEEGDIGAVFGLGFPPCLGGPFRF
SDLYGAHKLVDRMKKYEAVYGKQFTPCQLLIDHANNPSKKFYQ
Download sequence
Identical sequences F7FE46
XP_001380198.2.35504 ENSMODP00000019732 13616.ENSMODP00000019732 ENSMODP00000019732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]