SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000022571 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000022571
Domain Number 1 Region: 829-957
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.84e-16
Family cAMP-binding domain 0.025
Further Details:      
 
Domain Number 2 Region: 580-694
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000502
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000022571
Sequence length 1075
Comment (Monodelphis domestica)
Sequence
VKMKDSHFPLPLILFFIGCSFEILSFASYQVKQYAEMLQWMDPVIFINLFTPIIIFSVSF
DIDFYMLQKLFWQIIFLTVPGFFLNYALVDWYLFSVNKLLLKGITRMLFAIIIVCTDPML
TTTAIKNLGLSKGLTHLIKGECVFMAALAENTFKITLQIANNHHKEISTKLGIIILSDIL
IKFVGSSLFGFVMYKAFQLWLRNIFSDDITEGMLSFSLIYISFYVAEWSGMSGIITLTVL
ALLLNSTSFKPGAQLFLFKFWKSLKFFAYLMIFTLIGLMIPAHTYLYLSFSDIYYAVHFY
FTLIVIRILVFLIMSPILSRLGYGFTWRWAFTIVWSEMRGLLNINMALMFSYTDNALGTE
GEKSQILLHGVTICLITLMINSITLPRAVIQLGLRDITLTQRKSLYYTVQHFQGIIKASA
SALRFDRDLANADWNLVDKKIMFTNPYKLKPEEERQNLKCPDCNKEIREASINTEIMELA
RIRLLSAQIASYERQYIHEILSQSAVKVLVGAAGSFGDKKGEFMSFQTIRAYAEKKKFFN
FVRKILLNWVYNTRKEKGVPSKNPVLLFCHKIVFNDEFESSVYLIIILNMAPLLISWIPQ
LYVIYEKEARTVNHMFLSFYIIESILKLAAMRKGYFQHNWNLFELLIIVLGIIEEILMVT
DAFKNSIYVFQALIVLKISNLLRVFRILKLITPVLLQVIDRRMTHQLSFRYAILKGYVQG
EADIACLIDKISSSKLVAEELRKRVSMNAERAMKELGYLEYDHPDIAITMKTKEEINSLL
GMASEILKNLKSKGIINKAEVAEIHKIIMAKRKHVFDFEPVIKLPSLDEVLYHISWLNKS
KFHINFIKKKVKILTFDCGNNIFEEGDSPRGIFVIHSGMIKRHSSKPYLGLDQQLLETKE
KEKTVYADYLLSGAIIGELNCLTEKPMTFTATCKTVVETYFINKRDIYDIFNNCCPSIEY
KMWLKLALAIGAKKVKEILAYEDWTYNLQLQLCNVYVRDVLLGYKVDIYDETVSYVILVY
GSVEDCQLQKTYFAPELIPKTCHQIKGTARITKILVIQTSIDLKKCRSNTARYVP
Download sequence
Identical sequences 13616.ENSMODP00000022571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]