SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000023962 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000023962
Domain Number 1 Region: 126-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000642
Family EGF-type module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000023962
Sequence length 237
Comment (Monodelphis domestica)
Sequence
MKAPLQPPPPLTPSPVLLSLLVLSAVCHHVAASDTNDTYPERKDLFSGDHSTDGVELPSG
SEMSSGTEYDYSGEYEEDPQLSGYFIDDSIRVGRLVKPKKNRTESEKNSDKTRRKKNRGK
KRKPKKKVNPCDAKYQSYCIHGECKYIESLEAVTCKCHQDYFGERCVEQSMKTHSLGDGG
RFGTALAIVAGLLSVLCFSAIVVIIVQIRKVHSNVHDLEAEERRHLRQENGNGSIRV
Download sequence
Identical sequences F7A8Y1
XP_007495739.1.35504 13616.ENSMODP00000023962 ENSMODP00000023962 ENSMODP00000023962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]