SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000026078 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000026078
Domain Number 1 Region: 212-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 92-144
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-16
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 3 Region: 250-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000738
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000026078
Sequence length 300
Comment (Monodelphis domestica)
Sequence
PDLLTCGRCLLTFPLSQIVAFIEHKKGRCQRPAWGQRPDPDGDAGEYSGVRPAAPRTSPF
GLGPHLAARLGEVSGWPGLVGKRAGGGGVRTRSHSCDFCGKAFRSHSNLTVHRRTHTGER
PYRCPRCPYACAQSSKLTRHLRTHQRVEPGAAPAPPEPADHAAAPSGLVPPPGPASGGSG
EEGGGGEPGSPGAPPAGPGEDADGGGRRRGDTCEFCGKVFRNSSNLTVHRRSHTGERPYA
CPLCPYACAQSSKLTRHLRTHGPAPGPPPFQCPHCLVPFGLRATLDKHLKRQHGEPGSAG
Download sequence
Identical sequences F6R0Q2
ENSMODP00000026078 ENSMODP00000026078 13616.ENSMODP00000026078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]