SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000027156 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000027156
Domain Number 1 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 550-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 42-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 606-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 98-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.42e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 662-717
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 245-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 9 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 10 Region: 480-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 11 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 12 Region: 4-56
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-19
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 13 Region: 145-177
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000166
Family Classic zinc finger, C2H2 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000027156
Sequence length 717
Comment (Monodelphis domestica)
Sequence
TGEKPFKCNDCGKVFSHRSKLIIHKRIHTGEKPFKCHDCGKAFIRSSHLLQHQRIHTGEK
PFQCHDCGKAFNQNSHLLQHQRIHTGEKPFKCDDCGKAFNQNSNLSVHQRIHTSERPFQC
NDCGKAFNRSSHLLQHQRIHSGEKPFKCDDCGKAFNQNSHLLQHQRIHTGEKPFQCHGTG
KAFNPNSNISIHQRIHNIERLFKCNDCGKAFKQSSHLLQHQRIHTGEKPFQCHDCGKAFN
QNSNLSLLQHQRIHTGEKPFKCNDCEKAFNRSSHLLQHQRIHTGEKPFKCDDCEKAFNRS
SHLLQHQRIHTREKPFKCDDCEKAFNRSSHLLQHQRIYTGEKPFKCHDCEKAFNQSSHLL
QHQRIHTGEKPFKCDDCEKAFNQRSNLLQHQRIHTGEKPFKCDDCGKAFNQNSHLLQHQS
IHTGEKPFKCNDCEKAFNGSSTLLKHQRIHTGEKPFQCHDCGKAFNQSSNLLQHQRIHTG
EKPFKCNDCGKAFNRSSNLITQTRKLIHTGEKPFKCHDCGKAFNQSSTLLQHQRIHTGEK
PFKCHDCGKAFNQSSNLLQHQRIHTGEKPFQCSDCGKAFNRSSHLFQHQRIHTGEKPFKC
DDCGKAFNQNSHLLQHQRIHTGEKPFLCHYCGKAFNWISNLLQHQRIHTGEKPFKCSDCG
KAFNQNSNLIKHQRIHTGEKPFKCNDCGKAFNQSSNLIVHQRIHTEKEPYKCEGCEK
Download sequence
Identical sequences H9H8N0
ENSMODP00000027156 ENSMODP00000027156 13616.ENSMODP00000027156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]