SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000028978 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000028978
Domain Number 1 Region: 1824-2070
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.16e-52
Family Ankyrin repeat 0.0000000475
Further Details:      
 
Domain Number 2 Region: 1136-1272
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000526
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 594-725
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000267
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 412-536
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000487
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 937-1067
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 757-799
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000108
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 7 Region: 795-832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000005
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 8 Region: 532-574
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000185
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 9 Region: 873-915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000318
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 10 Region: 208-335
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000408
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 11 Region: 145-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000477
Family EGF-type module 0.018
Further Details:      
 
Domain Number 12 Region: 834-879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000062
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 13 Region: 716-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000322
Family EGF-type module 0.02
Further Details:      
 
Domain Number 14 Region: 1267-1310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000734
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 15 Region: 66-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000783
Family EGF-type module 0.018
Further Details:      
 
Domain Number 16 Region: 1065-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000804
Family EGF-type module 0.032
Further Details:      
 
Domain Number 17 Region: 1427-1459
Classification Level Classification E-value
Superfamily Notch domain 0.000000131
Family Notch domain 0.0014
Further Details:      
 
Domain Number 18 Region: 1308-1348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000232
Family EGF-type module 0.02
Further Details:      
 
Domain Number 19 Region: 377-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000286
Family EGF-type module 0.024
Further Details:      
 
Domain Number 20 Region: 1380-1417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000441
Family EGF-type module 0.011
Further Details:      
 
Domain Number 21 Region: 1506-1537
Classification Level Classification E-value
Superfamily Notch domain 0.000000458
Family Notch domain 0.0038
Further Details:      
 
Domain Number 22 Region: 335-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000232
Family EGF-type module 0.017
Further Details:      
 
Domain Number 23 Region: 111-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000322
Family EGF-type module 0.027
Further Details:      
 
Domain Number 24 Region: 28-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000179
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  13616.ENSMODP00000028978
Domain Number - Region: 189-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000215
Family EGF-type module 0.0071
Further Details:      
 
Domain Number - Region: 1469-1500
Classification Level Classification E-value
Superfamily Notch domain 0.00209
Family Notch domain 0.0084
Further Details:      
 
Domain Number - Region: 911-942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0145
Family EGF-type module 0.0056
Further Details:      
 
Domain Number - Region: 1118-1144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0629
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000028978
Sequence length 2476
Comment (Monodelphis domestica)
Sequence
MPALRPVPLCLLLGLWLCQGAPTLAIQCLDAFKPCVNEGKCVTYHNGTEYCKCPEGFLGE
YCQLQDPCERTRCQNGGTCVPLAMQGKATCRCAPGFTGEDCQYSTSHLCFVSRPCHHGGT
CITRSQDTYECICPSGRTGKQCQWIDACLSQPCANGSTCTTMANQFSCSCPAGYTGQKCD
TDLNECDLPGRCQHGGTCLNLPGSYQCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGNTCERNIDDCPNHNCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECQLQPNACQNGGTCTNHNGGYGCVCVNGWSGDDCSENIDDCAFAACTPGSTCIDRVASF
SCTCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGAACTDDVDECA
MANSNPCEHAGKCVNTEGAFHCECLKGYSGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGKCVDKVNRFQCVCPPGFTGSVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFNGLLCEENIDNCDPDPCHHGQCQDGIDSYTCICNAGYM
GAICSEQIDECLSSPCLNEGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCAQGICI
DGINRYNCVCLPGFTGQRCNVDIDECASNPCRKGATCINDVNGFRCICPEGPHDSSCYSQ
VNECLSNPCIHGNCTGVANGYKCLCEAGWVGTNCEVDKNECLSNPCQNGGTCDNLVNGYR
CSCKPGFKGYHCQVNIDECASNPCLNQGTCTDDISGYTCHCILPYTGKNCQTVLDPCNPN
PCENDAICQESQNFESYTCLCAPGWKGPRCNEDIDECVSKPCMNRGLCHNTEGSYLCKCL
PGFTGVDCEEDIDDCLANPCQNGASCVDGVNTFSCLCLPGFNGDRCQTDMNECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGTHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGP
FCLHEINECNSHPCLNEGTCIDGLGTYRCNCPLGYTGKNCQTLVNLCSRSPCKNKGTCTQ
RKAESQCLCPSGWTGAYCDVPKVSCEVAASRRGVPVNRLCEHSGTCIDAGNTHHCQCPLG
YTGSYCEEQLDECASNPCQHGATCKDYVGGYRCECIPGYQGVNCEYEVDECQYQPCQNGG
TCIDLVNHFKCSCPPGTRGLRCEENIDDCAPDAGGPHCLNGGQCVDKIGGYTCRCLPGFA
GERCEGDINECLSNPCSSEGSLDCIQLINNYSCVCRSTFTGRHCETFLDVCPQMPCLNGG
VCAVASNMPNGFICHCPPGFSGARCQSTCGHMKCKKGEQCVHTTLGPRCFCPRPEDCETG
CASGPCRHGGSCSPQKEPPYYACRCPPSFWGSHCEFSSGPTLGPPPTCLSRHCADKARDG
VCDEDCNSHACHWDGGDCSLTMEDPWANCSSPLPCWDRINHQCDELCNTAECLFDNFECQ
GNSKTCKYDKYCADHFNDNHCDQGCNSEECAWDGLDCATDQPENLAEGTLVIVVLMPPAQ
LLQDARSFLRSLGTLLHTNVRIKQDAQGALMVFPYYGEKTTVAGKKPGLTRRSLPEEHEQ
EVAGSKVFLEIDNRQCVQASEQCFKNTDAAAALLASQAIQGTLSYPLVSVLSETPDPKPT
RLLYLLAVAIVIVLLIMLLGVILAKRKRKHGSLWLPEGFILRRDSNNHKRREPVGQDAVG
LKSLSVQVPEGNLIDSSTNEHWVDDGAPQPKRTKAEDQALLSEEDDPIDRRQWTQQHLEA
ADIRRTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSEDDEEADDSSA
NIITDLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHA
AVAADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMVAELINCQADVNAVDDH
GKSALHWAAAVNNVEATLVLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANR
DITDHMDRLPRDVARDRMHHDIVRLLNEYNVAHSPPGTVLTSALSPVICGPNRSFLNLKH
TPGGKKPRRPNAKGAMPSSLPNLAKEAKEAKGGRRKKSLSDKGQLSESSVTLSPVDSLES
PHTYVSDTTSSPMITSPGLLQASPSPMLAAAAPAAPVHAQHAVSFSSLHELQPLGHGTAT
VLPSVSQLLPHHHLAQAGSGAGSARLHRVAVPADWMSRMEMNETQYNEMFGMVLAPAESA
HSVLAPQSRPGQPDGKHIAPSQEPLPPIMTFQLIPKGSIAQPAGAAQPQASCPPAVAGPL
PAMYQIPDMARLPGVAFPAGMMPQQDGQAAQTVLPSYHPFPSSVGKYPTPPSQHSYASST
AAERTPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGSGGGQRGPG
AHMAEPPPRTNMQVYA
Download sequence
Identical sequences F7AVD5
ENSMODP00000028978 XP_007485364.1.35504 13616.ENSMODP00000028978 ENSMODP00000028978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]