SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000029654 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000029654
Domain Number 1 Region: 271-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.3e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 103-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 159-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 215-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.01e-24
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 47-104
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.43e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 1-48
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-22
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000029654
Sequence length 336
Comment (Monodelphis domestica)
Sequence
HQRIHSGEKPYECKQCGKAFTESSSLARHQRIHTGEKPYECKQCGKVFTQSGHLVAHTRI
HTGVKPYECKQCGKAFTQRGHLIVHERIHTGMKPHECKQCGMAFTDRRSLARHQRIHTGV
KPYECKQCGKAFTRRDNLAKHQRIHNGEKPYKCKQCGMAFTERRSLARHQRIHTGEKPYK
CKQCGKAFTERGHLVAHKRIHTGVKPYECKQCGKAFTRRDNLAKHQRIHNGEKIYKCKQC
GMAFTERRSLARHQRIHTGEKPYECKQCGKAFTQRGHLIAHKRIHTGMKPYECKQCGKTF
TQMGSLAAHKRIHTGEKPYECKQCGKAFTQRGHLSA
Download sequence
Identical sequences F6XK92
ENSMODP00000029654 ENSMODP00000029654 13616.ENSMODP00000029654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]