SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000029771 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000029771
Domain Number 1 Region: 110-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.08e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 51-106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 18-65
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000458
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000029771
Sequence length 170
Comment (Monodelphis domestica)
Sequence
RGQRCHMCEAICLFSSSQQCGKTFSHSSSLCVHERIHTGNKPYECKKCGKSYSQKSHLAV
HQRMHTGEKPYECKQCGKSFRLSCTFAVHQRIHTGHKLYECKQCRRTLSTNFRLAIHQRT
HTGEKPYECKQCGKAYSRRYSLAVRQRTHTGEKPYECKHCGKAFTNNSSF
Download sequence
Identical sequences F6T8Z3
ENSMODP00000029772 ENSMODP00000029771 13616.ENSMODP00000029771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]