SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000031562 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000031562
Domain Number 1 Region: 470-644
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-48
Family SPRY domain 0.0000502
Further Details:      
 
Domain Number 2 Region: 26-138
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-18
Family V set domains (antibody variable domain-like) 0.00016
Further Details:      
 
Domain Number 3 Region: 152-227
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000202
Family C1 set domains (antibody constant domain-like) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000031562
Sequence length 665
Comment (Monodelphis domestica)
Sequence
FLSSLLFICLMFLFSLQMPVRGTEQFVVLGPTEPIVALLGTDIILPCLLSPLMSAEHMEV
RWFRSQFSEAVIVFQKGKEETDEQLVEYTGRTELISEFITEGRLAVKIYNVQISDNGKYQ
CYFRKGDVYEQASLEVKVAGLGSAPHLRLEGHEDGGVKLACMADGWFPQPQVQWRDNRGG
KLSSLSETQAQDEAGFFHMKALIVVQESSVRNVSCSICNKLLSQEKISAIDIPGQFSVLK
RMIRVGVDGTGERTISFFPKTSPWKKALSGILPVVGILLGISIFFILKERKKTKKLLQEK
KEDKKDKGKGEKQSGEMSRNFVLVSWWKAHIYAGESLLFPRTTISGDFLSWLHKRGRKGT
RMKAEGGCKDSVESAMVSLWDCPTDPRTLHLFYPLWKRDSGMRKQPSCTVSFAKAFHNTR
FSIGSQLLSSSDEGGPCAERNLWQGLIRERLGASSSWPLSHAFSWTCIDLVSLSAVNVTL
DPASAHPGLVLSRNGKDTKVENAVKNAEEKCSVLGREPITSGRHYWEEKVEMEAQNKATW
YLGICREGVSRSGWVRESPEEGFWIIGCYDGTFQPIVSKQSVAPSLEKPPEQIGIFLDCE
AGDVSFYNMTDGSHIYNFPPASFSGPVHPYFSIQTLDTSFTICGVSDRPESIPAPSLETP
GTAQE
Download sequence
Identical sequences F6SEU9
13616.ENSMODP00000031562 ENSMODP00000031562 ENSMODP00000031562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]