SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000038257 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000038257
Domain Number 1 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-20
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 154-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000584
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 106-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000026
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000038257
Sequence length 197
Comment (Monodelphis domestica)
Sequence
VTFEEVAVYFSQEEWAVLDQQQKELYQDVMRGTYELVTSMGYPAANPDIICKIEQEEEPW
TRDSRTTTKATAPGSMLFPRIKGPMCASSVGKASERPEISSSIMVTCGDCGQRFHLKQIL
VSHKGTHIQERPYCCPQCGKCFSQKHHLRSHHVYTGERPFTCSRCSRCFSKKHHLVSHQR
IHIGERPFTCVSCSKSF
Download sequence
Identical sequences F6QZJ7
ENSMODP00000038257 13616.ENSMODP00000038257 ENSMODP00000038257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]