SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 13616.ENSMODP00000038388 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  13616.ENSMODP00000038388
Domain Number 1 Region: 143-430
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.62e-132
Family Enolase 0.000000000759
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.24e-57
Family Enolase N-terminal domain-like 0.00000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 13616.ENSMODP00000038388
Sequence length 431
Comment (Monodelphis domestica)
Sequence
MSILKIHAREIFDSRGNPTVEVDLHTHKGIFRASVPSGASTGIYEALELRDGDESCFLGK
GVSKAVANINDTIAPALIEKKMNVVEQDHIDKFMIELDGTENKSKFGANAILGVSLAVCK
AGAAERCIPLYRHIADLACKEDLILPVPAFNVINGGSHAGNKLAMQEFMILPIGAPSFKE
AMRIGTEVYHNLKNVIKEKYGQIATSVGDEGGFAPNILENKEALDLLKEAISKAGYTDEV
VIGMDIAASEFRRDGKYDLDFKSPDDPSRYVTAKDLMDMYKSFIKDYPVVSIEDPFDQDD
WEPWTTFTADAGIQVVGDDLTVTNPSRIKKAIQEKSCNCLLLKVNQIGTVTEAIKACKMA
QANGWGVMVSHRSGETEDSFIADLVVGLSTGQIKTGAPCRSERLAKYNQLLRIEEQLGCK
AKFAGKNFRNP
Download sequence
Identical sequences 13616.ENSMODP00000038388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]