SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4R6Q7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4R6Q7
Domain Number 1 Region: 2-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000105
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 2 Region: 63-102
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000000275
Family Zn2/Cys6 DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 148305.A4R6Q7
Sequence length 539
Comment (Magnaporthe grisea)
Sequence
MPYTCEVEGCGRVYQRKEHLNRHKKDHDEVKSFECPACGAKFSRGDTLRRHMNLHGPRAE
GPLPARVAKACVNCHKSKTRCDGREPTCSPCADKGRECAYPKRDGGGSSGGGGDNDARRV
SPPTSHPVEQVNVVQDAVLTMESMDVDVSMDAMVPSLPIMDMDMDMAANTSSDPSVQIAD
QQHMASMAGYPQFIPLPPDLETQMQPPLAAPTPPPPPNALQDLRNQQLAETYFTVFHPHW
PIIHRGTFMSNQQPELLTRAVMIIGLFFQGSAEARALAVQHHRKLLKEAQDKVVILSKKT
RQSFLSSPSAALLPHLQGILLAMILPTYLRDRTIDVTLAMSPVLTTVLAACGAHDQRRID
AANPLDRDSTAPWLMRESYQRLALLHYKLHLFASAVFVSIIPWNRIDRSLTPEMLHVRTP
FSRHWWEKLPVTWDPSAVPPFADGGGGGGGGGGDGQGQQGRDDDSFVLVSAIANRARAAG
TTEGLLPLFAWDRDFALAMGCWCTKPEAERDDHFVARLRPYLVNTLKISGDEIMLSLGA
Download sequence
Identical sequences G4N9Z9
148305.A4R6Q7 XP_003717564.1.18062 MGG_09780T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]