SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4RD12 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  148305.A4RD12
Domain Number - Region: 286-312
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00199
Family Retrovirus zinc finger-like domains 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RD12
Sequence length 1041
Comment (Magnaporthe grisea)
Sequence
MGIPAAFRWLSTKYPKIISPVIEDKPVEMEDGTSIPVDITKPNPNGEEFDNLYLDMNGIV
HPCAHPEDRPAPQDEEEMMLEIFKYTDRVFNMVRPRKVLMIAVGKDSKHYPKCELYINPI
QPLLDGVAPRAKMNQQRSRRFRSAQEAKEKAEDKLELLKLLKQQKGGDVSAETLESVTKK
AFDTNSITPGTPFMDILAGSLRYWCAYKLNTDPGWANVKIIISDATVPGEGEHKIMDFVR
SQRSSPDHDPNTRHVIYGLDADLIMLGLATHEPHFRVLREDVFFQQGKPRLCKLCGQKGH
DAQQCKGEVKKKEGEFDEKQNAEPLKPFIWLHVAILREYLNVELYVPDLPFRFDLERAVD
DWIFLCCFVGNDFLPHLPALEIRENGIITLTSIWKQNLPRMGGYVTKDGHIDLERVQYIM
DGLAKQEDSIFRKRKEQEDRRDANAKRRKMQDDRAKWGNNSANGPHVSEPAKAITHDMVV
NRAAAQVDANVANKSAASMLKSQLKAMQSQAPEASAPETPVKEGAASEETTPASALGKRK
AALMEDGDSPAPNSPTPGTPASGNGEAVDTVRLWEDGYTDRYYEQKFHVDPKNVEFRHKV
AHAYVEGLSWVLLYYFQGCPSWEWFYPYHYAPFAQDFVGLKDLEISFEKGRKSKPYEQLM
SVLPAASRDNLPPIFHDLMTKEDSEIIDFYPEDFEVDLNGKKFAWQGVALLPFIEMDRLL
AAVQAKYPELSADEAARNGLGRDVLIISDAHAPLYDDLITNFYSKRQTGSTYKLDQKNSD
LLAGVVEKLPDYLPHGALVYPLERKCMPDVEYDRSLTVYYDMPQAVAHKSMLLRGLKMPT
PALTRHDIDDLKNKMRGGGGRGGYGGGRGGGGYGGGGRGGYNGNNGNNNNGGHRNGVESY
NSRDQRGGRPPQNQSWQPPPPGSAGFGMGVPPPPPPAHHYGGHGGGYNDRYAQQGYPPSY
PQYPPPGQGYPPAYPPSYGPPPGQYGGGGGGHYPPPPPPGHNQSYRPDDRGYRGGYNGGR
DRGPPRGGGGGGGRGRGGYGR
Download sequence
Identical sequences L7HY59 L7JHD4
148305.A4RD12 MGG_11426T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]