SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 148305.A4RI17 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  148305.A4RI17
Domain Number 1 Region: 2-48
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000257
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 2 Region: 67-109
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000549
Family Zn2/Cys6 DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 148305.A4RI17
Sequence length 973
Comment (Magnaporthe grisea)
Sequence
MFCAYCGQKFTRKEHLERHIPTHTNVKPHRCTACGISFGRRDLLTRHYQAYHEARDPMEP
IPGSAPPVAGRTPIACQNCANAKTGCDKRVPCSRCAEKNLDCAARYARRSSKAAVRAAQA
SAAFHNSQIPNPTTTMHHQPHPHHHNHVQVVNPAMMEIDPAMPKQESLVQTPEGVEPQAL
METSRLHTSPQQKSPLTSHHQSPLEFPSPHPRQEGMEDFMHLSTEFPGTESHYNDLMIWP
DYPLDLEMYPSQIPMTRPDLAVQPFADLGSEISSTSEPMATSSSRGSTHTRGTSILSSAE
FETSMKPADLAAAINTPAGSSIAEFEVVIAAEAAWPLARCNPPIYSNTCPRTAIVHLECL
EQKSKVEGTWSSLEKYMEQVDWDAADLSSVVPITSRTRDKMLAITQGFLHKALDIHRGGI
TGFSNQGHHRPGDFNFIVLPPTKILEYFLRSYIRTLSPYYSLSLGSCVDPNEMLRDNHAS
TLLVLLMIAQGAAAVPMAEARYLSTGLVETCRISLFDIIEKNVELSADPTALRCALLFTL
LGAWSGDKWLMDISMGQRGMYMSMVKHAGMMDSQPPMIPVFTNSTSTELEWRAWCHRESQ
NRLVYNWVMMDQELSLFHDTAPLISISDLLCPLPGPDELWTAPNSEVWLSSVQSLYGGNN
VNVNPQLLSTPSPTPSLSDLFRSFLHDNLTPGKNSLSPQHLRLLLHPLQSLLCHLRQMLS
CFPDIPSTRRTTTRTVTRASTLSRLEEVQALLQKWYELSMEFSKESPDCPITRCNMVLYH
LISLNAVTNFPEVERLARREGFDGSYWELSMRHKMCIYQREEAVFHCGQVLRLVRSMPQD
RRPVWWSAAVYRAVLILWADSMARLDPTLKREDTVGPSSTPAAAATPGPLVPVDQVTPEN
PAVIAYLWNREGVALLTRNDGRSVSLDNPAEVLAYGVKEIEEAVSIRFSDGIKRKLAALA
QNWSVGSPLAGSS
Download sequence
Identical sequences G4MU22 L7HZ41 L7IXD8
XP_003715429.1.18062 148305.A4RI17 MGG_07215T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]