SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G06270.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G06270.1
Domain Number 1 Region: 127-386
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-83
Family Protein kinases, catalytic subunit 0.000000946
Further Details:      
 
Domain Number 2 Region: 425-565
Classification Level Classification E-value
Superfamily EF-hand 8.26e-46
Family Calmodulin-like 0.00000678
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G06270.1
Sequence length 590
Comment (Brachypodium distachyon)
Sequence
MGNNCVGPNAPGRNGFLASVAIWRPAAARPDPAAPAPDAPPQTTFSDKAPEPVTIPASEH
SSHHSSRAADPPPPKAAEPQPAQAQTQAPAPAAKKPVPKVKRVQSAGLQADSVLKRDVNT
ARLKDLYTIGKKLGQGQFGTTYLCVEKATGKEFACKSIAKRKLLTEEDVEDVRREIQIMH
HLAGHSNVVSIVGAYEDAVAVQLVMELCAGGELFDRIIQRGHYSEKAAAQLTRVIVGVVE
ACHSLGVMHRDLKPENFLFVNQNEDSPLKAIDFGLSIFFKPGQMFTDVVGSPYYVAPEVL
LKHYGREVDVWSAGVIIYILLSGVPPFWDESEQGIFEQVLKGELDFSTDPWPSISESAKD
LVRKMLIRDPKKRLTAHEALCHPWVCVDGVAPDKPLDSAVLSRLKQFSAMNKLKKMALRV
IAESLSEEEIAGLKEMFKMLDTDNSGHITLEELKSGLQRVGATLMDSEIDALMEAADIDN
SGTIDYGEFIAATMHINKVDKEDKLFTAFSYFDKDGSGYITQDELQKACEEFGIGDTHLE
DIIGDVDKDNDGQIDYNEFVEMMQKGNNPLGRKGQQSNVNFGLGDALKLR
Download sequence
Identical sequences I1GMG5
XP_010228730.1.954 EG:BRADI1G06270.1 15368.BRADI1G06270.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]