SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G16770.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G16770.1
Domain Number 1 Region: 74-199
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.93e-25
Family D-Alanine ligase N-terminal domain 0.0052
Further Details:      
 
Domain Number 2 Region: 488-566,616-668
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.16e-22
Family D-Alanine ligase N-terminal domain 0.0053
Further Details:      
 
Domain Number 3 Region: 201-456
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.52e-22
Family ATP-binding domain of peptide synthetases 0.012
Further Details:      
 
Domain Number 4 Region: 678-921
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.26e-16
Family ATP-binding domain of peptide synthetases 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G16770.1
Sequence length 946
Comment (Brachypodium distachyon)
Sequence
MLLLSLAQAPPLLLPATTPRAPSRRREPASASLRRLASRARGVSVAPRPVRAVVAGREAE
GMAAAGAEQEGRPLRVGLVCGGPSAERGISLNSARSVLDHIQGEDLLVSCYYIDCGMNAY
GISPAQLYSNTPSDFDFKLESLAQEFRSLSEFTEHLAANVDIVFPVIHGKFGEDGSIQEL
LEKTNVPFVGTPSNECRRAFDKHSASIELNAQGFLTVPNFLVEKDKLAKSELEQWFQSIN
LNKENGKVVVKPTRAGSSIGVVVAYGANDAAEKAEGIISEGIDDKVIVEVFLEGGCEFTA
IVIDVGTANTSEPVVLLPTEVELQSSGNNDIQEDTIFNYRRKYLPTRQVTYHTPPRFPPE
VIGCIRQGVSLLFRHLGLRDFARIDGWFLPTPVSTLSSGENGGRFGNTEYGTVLFTDINL
ISGMEQTSFLFQQASKVGFSHSRILRTIVQHACSRFPSLVPCNNSWTALSRKMQSAKQAE
VIQNGTHKQKAFVIFGGDTSERQVSLMSGTNVWLNLQGFEDLDVTPCLLTPANGYSSSHN
QDGESSRDVWTLPYSLVLRHTTEEVHAACLEAIEPERVEITSRLRDQVMKELEQALSKQD
WFAGFDIADEQPTKYSLQQWIDHVKEAKAVVFVAVHGGIGEDGTIQLMLESAGVPYTGPG
PIASRTCMDKVATSLAVDHLAGYGIHTIPKGVRETDELLSSSLVDIWNDLKSKLQTETVC
VKPARDGCSTGVARLCCPEDLEVYVTALRRKLQRLPANCLSRAHGVIEMPVPPPESLIFE
PFIETDEIIISNKSRDDSARHLVWKGEKEWLEVTVGVVGKCGEMHSLNPSITVKESGDIL
SLEEKFQGGTGINLTPPPATIMSEDALRKCKSCIEMMANTLGLEGFSRIDAFVNVRNGEV
LLIEVNTVPGMTPSTVLIHQALTEDPPIYPHKFFRTLLDLAFARAN
Download sequence
Identical sequences I1GQW8
XP_003559752.2.954 EG:BRADI1G16770.1 15368.BRADI1G16770.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]