SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G50590.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G50590.1
Domain Number 1 Region: 1-287
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-93
Family Protein kinases, catalytic subunit 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G50590.1
Sequence length 475
Comment (Brachypodium distachyon)
Sequence
MERYNVITEVGDGTFGSVWRAINKENGEVVAIKKMKKKYYSWDECINLREVKSLRKMNHP
NIVKLKEVIREHDMLFFVFEYMECNLYQLMKNKGKPFSETEIRNWCFQIFQALSHMHQRG
YFHRDLKPENLLVTKEVIKVADFGLAREISSEPPYTEYVSTRWYRAPEVLLQASVYSSAV
DMWAMGAIIAELFSLRPLFPGSSEADEIYKICSILGTPNPRTWAEGLQLAASINFQFPQL
ESIHLSEVVPSASEDAVNLISWLCSWDPRRRPTAVEVLQHPFFQPCFYIPPSLRFRSTGY
ATTPPSAGARGALDLKNTRRYPAGTLSNEKPTVNYSYMSTTNTPARAAGVQRKLELDHQV
KVESNHKLMKENAMNQPWSRPPPPAVRSNGNYLTKDQSPRAPDIAEKLSQLTMASNRTPV
LSSDRFADMKARAHGDTARRPLPLGSRAWRAPTDPFRRTYEMPGERALLQRKLVS
Download sequence
Identical sequences I1H1G8
XP_010228082.1.954 15368.BRADI1G50590.1 EG:BRADI1G50590.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]