SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G63660.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G63660.1
Domain Number 1 Region: 138-227,373-510
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.75e-25
Family Calcium ATPase, transmembrane domain M 0.037
Further Details:      
 
Domain Number 2 Region: 225-296,331-369
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.00000000000000209
Family Calcium ATPase, transduction domain A 0.0065
Further Details:      
 
Domain Number 3 Region: 503-544
Classification Level Classification E-value
Superfamily HAD-like 0.0000148
Family Meta-cation ATPase, catalytic domain P 0.063
Further Details:      
 
Weak hits

Sequence:  15368.BRADI1G63660.1
Domain Number - Region: 510-628
Classification Level Classification E-value
Superfamily HAD-like 0.0214
Family Meta-cation ATPase, catalytic domain P 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G63660.1
Sequence length 671
Comment (Brachypodium distachyon)
Sequence
MRPDRPFLPPPHPSLPQATAADMELPARLPSPILKHSPSASAMTSRSLRDTSSVTFAADS
IRSRSSKPEFISTSPYSSFESESFRTARTSRPSASVVSRSSTRRSASERAGGSQRDLRDE
DARFVYINDEPRTNAPPATFPDNSVHTTKYSVLTFLPRNLYEQFHRVAYVYFLILAALNQ
VPQLGVFSPAASVMPLAIVLSVTAVKDAYEDWRRHRSDKKENNRTACVLDPADGVFRPKR
WKEMQAGDVVRVVADETMPCDMVLLSTSDPTGVAYVQTINLDGESNLKTRYAKQETMLRT
TPPEALAGAVIKCEKPNRNIYGFLATVDLDGRRAVSLGTSNIMLRGCELKNTAWAIGVAV
YTGRDTKVMLNSSGAPSKRSRLDMHMNRETIALAVILVILCSVVSLLAGIWLGDHDDMLG
VIPFFRKYDYSNDRQGVGKYNWYGTGAQVAFTFMSAVMLFQVMIPIALFISMEIVRVGQA
YFMVQDKHMFDQQRQARFQCRALNINEDLGQIKYVFSDKTGTLTENRMEFRCASVHGRDF
SDTDGGQEDGHAVLADGVVLRPKTAVKTDEKLLAMLKDGTGAKAGRARDFFLALATCNTI
VPIVQDAADDPAAKLVEYQGESPDEQALVYAAAAYGHTLVERTSGHIIVHVFGTRQRYGT
HPSTLGVPIWP
Download sequence
Identical sequences I1H5X9
EG:BRADI1G63660.1 15368.BRADI1G63660.1 XP_010230161.2.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]