SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI1G78380.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI1G78380.1
Domain Number 1 Region: 419-698
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-65
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 722-791
Classification Level Classification E-value
Superfamily RING/U-box 4.68e-20
Family U-box 0.0049
Further Details:      
 
Domain Number 3 Region: 19-141
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000000327
Family Universal stress protein-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI1G78380.1
Sequence length 795
Comment (Brachypodium distachyon)
Sequence
MAIQEEGEGAGSADAPLTVGLALGGSKSSTYVFRWALAKFANGKDKPAPIFKLIHVLTPV
LAVPTPLGNYIPIDEVRPDIAEAYAKEVHVQAQEMLLPYRKMCDENKVEVEVLLVKGDDV
ADTISNLVTQYKIRVLVVGNPTSRSAFTRKSSGNKASSKICKSIPSFCTTYIVSKDGLSS
VYSPGLGSETSSCRSSDSQAFSGEMSLRSDLSDSSARTLLGLLSLPSSNLASENLKSSSS
AERNRSFTLYDYISGSASVYADKDRRITSCTDSESSISSRLRASNKAPTQGSSLRGLMLS
ETKDDVNIELEKLRLELRHVQGAHKLVQDESADASRQVVELAAKRVEGKAQLREIQSRVD
KANDEVQEEKARRCATEEVVTHVKDLVRAEVMQKNRLLIKASKVADQKSRLEELFVLHGN
SYSTFTWEEIDNATSSFSESRKIGAGSNGTVYKGHLNHLDVAIKVLHSDDRSSTKHFNQE
LEVLGRIRHPHLLMLLGACPDRGCLVYEYMENGSLADRLQCKNGTPSIPWFHRFRIAWEI
VSALVFLHSTKPNPIIHRDLKPENVLLDRDLVSKIGDVGLSTLVPLKDSSSSGTMYKKTG
LAGTMFYIDPEYHRTGQVSVKSDTYALGMVILQLLTARSPIGLPELVERAVEDDQLMDVL
DEGAGNWPAKEAHDLAQLGLSCLEMRSKNRPDLKNMVSVELERLKGIAIVASGPVQVVPG
LGPPSHFLCPILKTVMQDPCIAADGHTYERNAILMWLCEHDVSPVTKALLPNKTIVSNQS
LLSAISSWRSQGGGL
Download sequence
Identical sequences I1HAU9
15368.BRADI1G78380.1 EG:BRADI1G78380.1 XP_010229351.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]