SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI2G03820.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  15368.BRADI2G03820.1
Domain Number - Region: 71-174
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00942
Family Myosin rod fragments 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI2G03820.1
Sequence length 355
Comment (Brachypodium distachyon)
Sequence
MADRPPSPRLADEEDREFNASPSRNAAPVRSGEKRPFGDLDDDEEDVFASKKGKTKVEES
APGAATGMILSLRENLQNCKDNLASSQVELENAKSEIQKWHSAFQNTPAAPAGTNPEPVA
VLTYLNNLKSSEESLKEQLEKAKKREAAFIVTFAKREQEIAELKSAVRDLKTQLRPPSMQ
TRRLLLDPAIHEEFTRLKNLAEEKEKKIKELQDNVAAVNFTPSSKHGKMLMAKCRTLQEE
NEEIGAMASEGKIHELGMKIAVLKTQNKELRNQFDGLYKHMDGLTNDVERSNEMVLILQE
VLEAKNVELARLKEMVSQKDATEDKEAAEAIDETATDMNASPEPQPIKVESPNKG
Download sequence
Identical sequences I1HC86
EG:BRADI2G03820.1 XP_003568995.1.954 15368.BRADI2G03820.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]