SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI2G07880.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI2G07880.1
Domain Number 1 Region: 247-342
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000451
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI2G07880.1
Sequence length 411
Comment (Brachypodium distachyon)
Sequence
MGPLKSPSSPSDPRPRPTSSPRTRPRHERLPPPPPLPPPPPPPPPHVSSSVPPLPPPSQA
GDALELPPPPPLPLPPPPPLSTHPSHRASSSSCRATRTPPRHGTQPRRDSGQGTAVLALY
SPLPNRPARGEHSVEHLVHSRTTLPICGDAPGEDFAGVPTEMLPPKKRIARYHPYRAAPK
IQETASSHGSLGGSGMNRPVPLAAVGGDVGDMGVRRGGDGRRQEHQDDDAGLRAELHRLR
ISWPSLVLTKLLTPSDRSRDRARLVLPEGLVRASPLLDMMTSGERRLVYEDGGLAVPAFD
RLGRSYCITLKRSHGSYRLTGEWSLFVSQHDMRDGDAVEVLAFRPPGWQDRLGRCGEGGL
GMALLHCRSARDSWNNNGGCDAAGRLLHPDADPAPVARPSRRPRRRRRRAP
Download sequence
Identical sequences I1HDL1
EG:BRADI2G07880.1 XP_014754370.1.954 15368.BRADI2G07880.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]