SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI3G09170.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI3G09170.1
Domain Number 1 Region: 511-783
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.9e-79
Family Protein kinases, catalytic subunit 0.0000148
Further Details:      
 
Weak hits

Sequence:  15368.BRADI3G09170.1
Domain Number - Region: 186-237
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00981
Family Transglutaminase core 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI3G09170.1
Sequence length 792
Comment (Brachypodium distachyon)
Sequence
MDDLPDDREQSDTQSSDPNCLPSREEHKFQSISLAKQENNLDSADSSLDCREVDRSLCAS
QALWSTGSLSSPIPNGFYSIIPDKKLKECFDTIPSPEDLYSLGIEGFKAEIILVDLMKDK
KLSAIKQLCVALVKGLNSNPAAMIKKVAGLVCDFYKRSNPQLSPARTSSEEISHFMENRG
VQLLGQIRHGSCRPRAILFKVLADSVGIDSKLVVGIPNEESHEYDDSPKHMSVVVMLKSV
EFLVDLMRFPGQLVPFSSKAIITSHISAAGESDSADYDSCDSPLEPNSPLCSQRQEQDDN
SRSFKVPSLRNIMLRSTNSMEGKLRCSSHSEPNVANAFCGRSRRKVVNEHQRTASSSPEH
PMSRAHGRSMLGDRQYGDGVAVSRSDGASTSNARIGRRRSISIAPEIGDDFARAVKAMSE
SMRQNRLSRAHNDGSPGHSNDSERNESLGDFNGNEVSARESNVQEGPRRQISSQRALSLP
SSPHRLGSHASDLREPADFLTAADLMSTWNKVLQSSPFLNKPLLPFEEWHIEFSEITVGT
RVGIGFFGEVFRGVWNGTDVAIKVFLEQDLTMENMEDFCNEISILSRLRHPNVILFLGAC
MKPPHLSLVTEYMEMGSLYYLIHTSGNKGKLSWRRKLKMLRDICRGLMCMHRLKIVHRDL
KSANCLVNKYWTVKLCDFGLSRVMLDSAMRDNSSAGTPEWMAPELIRNEPFTEKCDIFSL
GVIMWELCTLSRPWAGKPPVQVVYSVANEGARLEIPDGPLRSLISDCWAEPDKRPSCQEI
LTRLLDCEYTLC
Download sequence
Identical sequences I1HZ57
EG:BRADI3G09170.1 15368.BRADI3G09170.1 XP_003571943.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]