SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 15368.BRADI4G21830.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  15368.BRADI4G21830.1
Domain Number 1 Region: 715-1019
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-67
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 262-603
Classification Level Classification E-value
Superfamily RNI-like 1.02e-60
Family Cyclin A/CDK2-associated p19, Skp2 0.061
Further Details:      
 
Domain Number 3 Region: 51-362
Classification Level Classification E-value
Superfamily L domain-like 3.74e-56
Family Polygalacturonase inhibiting protein PGIP 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 15368.BRADI4G21830.1
Sequence length 1043
Comment (Brachypodium distachyon)
Sequence
MRPRHLVLFLIFHLLSSNVYGNGVDGDDALHRDALALLSLKAALRCRPQALRSWSAGNIA
SVCSWTGVRCAGGRVVSLDIANMNVSTGAAPVSAALSPALDALQTLSLAGNGIPGAVTAS
SLPALRFVNVSGNQLSGALDVAWDFPSLRSLEVFDAYDNNFSSSLPSTIASLPRLRHLDL
GGNYFSGSIPSSYGNLQALEYLSLNGNNLEGPIPAELGNLENLKELYLGYYNSFSGGIPP
ELGNLRNLVILDVSNCGLTGRIPAELGELSSLDTLFLHTNQLSGQIPPELGKLTQLTALD
LSNNVLSGSIPGELGSLVSLRLLNLFLNRLHGPVPEFVASLPRLETLQLFMNNLTGEIPA
RLGASAAALRLVDLSSNRLTGPIPEPLCSSGMLRVVILMNNFLFGAIPGSLGSCASLARV
RLGQNFLNGTIPAGLLYLPKLNLLELQNNLLSGSIPSSPSPAGFISQLAQLNLSNNALTG
ALPGSLGNLTSLQTLLASNNRLSGPLPGEVGELRQLVKLDLSGNALSGPIPAAIGRCGEL
TFVDLSKNNLSGAIPEAIAEIKVLNYLNLSRNRLEESIPAAVGAMSSLTAADFSYNELSG
PLPDTTGGGQLGFLNATAFAGNPGLCGGPLLGRPCRNGMATGAGEDDGPRRPRGRGEYKL
AFALGLLACSVAFAAAAVLRARSCRGGPDGSDNGGAWKFTAFHKVDFGVAEVIECMKEGN
VVGRGGAGVVYAGPRRPGSSSMIAVKRLNNNNNYGARSGSGDHGFRAEIRTLGSIRHRNI
VRLLAFCTNDGLRANALVYEYMGNGSLGEVLHGKGGGFLAWDRRYRIALEAARGLCYLHH
DCTPMIVHRDVKSNNILLGDDLEARVADFGLAKFLRSGSGNNNNSSSNASECMSAVAGSY
GYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGRRPVGDFGEGVDIVQWAKRVTDGRREGV
PKVVDRRLSTVAMDEVAHLFFVSMLCVQENSVERPTMREVVQMLSEFPRHRSSQPSPSSS
SSAPEPEKEKEPNCYKLFPDLLT
Download sequence
Identical sequences I1IME7
EG:BRADI4G21830.1 XP_003576141.1.954 15368.BRADI4G21830.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]